Protein (view, download) , Domain
N9_Mbre         MLSSST----W--LVARFG-TLASPASTLAPKSPQTPSVPSSTRWFARTFKVRPSPFG--
8798_Mbre       MALFLLAHRAD--GSLLLLPLILNRTFASET-----------------------------
11892_Mbre      MFTHLHLATTI--LVL--G-TALLPQVTLAYTNAQCK-----------------------
22411_Mbre      MAPSHRSPCW---VVLSLLALVLVPTWANTKYD-N-----------AYITDITPRQVGYK
28702_Mbre      MRSHSCVLAMA--IALAV-AV--Q------------HVSAFK------------------
33646_Mbre      MAPRSVAAGLG--LLFSFLTLV-QP------RG-HAPAEPKEIHNHEYIFVIGQHH----
33995_Mbre      MGWGAPAAGTPTHRLLRLLGFILAFALGTEGTD-CY------------------------
34112_Mbre      MARHLFCALLA--G-LLLLALGMAPCLALEVGE-SYPDEPEGDAAQAIKEHVRPGSLAYQ
                *

N9_Mbre         ----------------------------------------------ARVFVTPT--TPCS
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      GGQ-------HITIRGVGFDREG--------------------QEGATTVYVGTDV--CE
28702_Mbre      ------------------------------------------------------------
33646_Mbre      --------------------------------------------SGTTI-L---DLILCQ
33995_Mbre      --------------------RQ---------------------VQGTCTVTCGEDVVGLR
34112_Mbre      ELVTMPVATEG-----VTFS--PGVSRIMSERMLNKLTRLGEYVKAACD----IDLVVTR


N9_Mbre         SS-------P------------TPLFSP-ITKFTCV---LAKPCLPLTRYIA-CLHLPPH
8798_Mbre       ------------------------------------------------------------
11892_Mbre      S-----------------------------------------------------------
22411_Mbre      T---------------------IAYYSSDT-QIVCV---MPEVTVV-ESYLAVTVSL---
28702_Mbre      --------------------------YTE---QE-P---EV-------------------
33646_Mbre      --------------------------HNN---ISCI---QRLSPRL-DPDPEMHRSL---
33995_Mbre      D---------------------VTYEYTNT-SEACLAVQMPEPTIT--SC----------
34112_Mbre      GYEIAPENSASLELFYEGRAVEITAAFTPTTTCENI---FEEVVVD--TCYAEMACM---


N9_Mbre         PGCSSFTKADLERMDCTEFV---------------MSPGDVLYMPKG------VV-----
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      WVAGGA-------MGSTAICETSCSVRARSVYTPTISESQLAAPPGGNVTLIGYL-----
28702_Mbre      ------------------------------------------------------------
33646_Mbre      PYCSSR-------MLSTPVLESNA-PQNEGQHLQHVYPS--ARKLGG------M------
33995_Mbre      ------------------------LAVSACNYCQDINM-TFARPLGK-------RTGTIS
34112_Mbre      ------------------------------------------------------------


N9_Mbre         ----HYAETKGSDLAVHMTLGL-----LQDSHTWQDVLQYACALANLSDCRVLDQTFEAI
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      ----RG--ITADEFELRLNGTL-----LETAYESDDVISTSS--WNTGRYDAVVPSMTAG
28702_Mbre      ------------------------------------------------------------
33646_Mbre      -----------QAYALHSEGHLLHNSSFMTSHSGQDLFRSWSRYWNTSNYYLLEKS----
33995_Mbre      TVLLT---------------------------------YSSTRTWRSANGIQL-------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         FKNQDGVAWRDLIPF--WRDNSDYGTTGKDVSETFVAASVAHIQQLLDASREKGLLASVR
8798_Mbre       ------------------------------------------------------------
11892_Mbre      --------------------------------------------------WG--------
22411_Mbre      YYN---------VSFLVNRQDS---SWGAGFSANYNSVWLAHKNTTY-------------
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ---------------------------ATFG-----------------------------


N9_Mbre         DALAQQPSYASSSQRLADFERLVAFLADSTQIAQVVEAIAAAGDGDENDAEGLDRLKRLR
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      -----------------DF-----------EVHPVVSALSASAAGTLG------------
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      -----------------------------------------AYSSNLG------------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         RSTSYYQSCSGCYCSGCDRDSSCDCSCSYYGWGWLWYWSSYSCDGCCDSS-S-NCDGGCR
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      ------------------------------GALLTVYGDGFDADACVENN-V-VSVAGVN
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------GWVLT-------------------------
34112_Mbre      --------------------------------------------TCPEQGSFIGNPDDCR


N9_Mbre         CYSGYAGNAYSGRCTRCSSGT--YASGSSCRSCPS--GK-YSTGSANSACRTCSAGKYMP
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ---------YSYACTPASPGHWSWVDGASNKNCAC--GQLYSSNSGTTCCNT--------
22411_Mbre      CVPVACTNTE------------ITCRLEAVVGVPE--SD-LPRGLAGSIF-SNSLGTWTP
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      CTK-TCASGS--------------CRCGSNVPVSDSCSA-LPNEDCFCVN-EESLDDSAD


N9_Mbre         YTGRSYCYTCPSGKYQPYSG-RTSCYTVPSGYYVSNNRVYRCQPGYYCTRGYR----YSC
8798_Mbre       ------------------------------------------------------------
11892_Mbre      --------------------------------------------RNVCTR----------
22411_Mbre      APAEVFNFTQTSGAHHYMRDFDTQYRQVLEGYFVPEA-----------TGDHR----FFC
28702_Mbre      --------------------------------------------------------GSSA
33646_Mbre      ------------------------PRHVIMTRFLQEA-----------FAPHPTYFLFIM
33995_Mbre      ------------------------------------------------------------
34112_Mbre      MTTQLVDLVQRAGFDWIMRV----STLVFHLSVIPDA-----------CESHID-LVFLL


N9_Mbre         RPGTYQPYSGRTSC-----------------YSCP--SNSYQPSYGATRCNSCSSG---Y
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ----------------------------------P--SNWRNNLGYVNTCLYCSWG---S
22411_Mbre      Q--------GDDRC-----------------YFDISTDESVENMTDSVAYSTYATS---Y
28702_Mbre      G--------LAIGLGL-----------------------------------GLVLTVLLA
33646_Mbre      R--------HPLGCSHYNWRRRWRA-----------------------LRTTCGREILLH
33995_Mbre      D--------GTY------------------------------------------------
34112_Mbre      D--------GSNSVSEPDWIRTKQFVVDMIEYFNVNT-----------TYSTIGTRVGLA


N9_Mbre         YSSGSSILACPRGYYCTGCRRYACTAGKYQSQTGKN------------------------
8798_Mbre       ------------------------------------------------------------
11892_Mbre      WS--------------------SCTCAGTQTRTKPN------------------------
22411_Mbre      WNSNNQI-SDPI--PLVAGRRYRCRIRHIQYGGGDFFKVGMHVSSPDVVLSPNEILHESL
28702_Mbre      ------------------------------------------------------------
33646_Mbre      W-----------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      WYSTNV------------------------------------------------------


N9_Mbre         -------------------YCNSCPTG--TYS---SSGWSSC-SSCSPGTYQNQYAQ-SS
8798_Mbre       ------------------------------------------------------------
11892_Mbre      -------------------NCGSETRGCTAYT---WLSWSSC-SCSSS-TR---------
22411_Mbre      RERQIIEFTSDVVREQHELVFNNVYNG--TFYLTLDGQWTTAVDLDSPSALADAFEDISD
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ---------------------------------------SKEFDLDTYD-----------


N9_Mbre         CKACSSSQYQNLYRQTSCKSCSTGYYRRTSSSQAYCPAGSRCPGSCSRYTCSPG---TYS
8798_Mbre       ------------------------------------------------------------
11892_Mbre      -----------------------------------TRSSSRC-GKTQTDSCDPF---SWS
22411_Mbre      CGSISASEAAGLVP----------------------------------------------
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ---------------------------------------AVA-GIGSSPSLLPFFTVSQT
34112_Mbre      ----SSEEAQCAVQ----------------------------------------------


N9_Mbre         LAGATSCSSCPSGQYQDQYGQSSCK-PCPSNQYTSSTGSTRCTTCT--------------
8798_Mbre       ------------------------------------------------------------
11892_Mbre      SW-----------------SDCSCA-TQRSTRTSSRCGTSQSRTCD--------------
22411_Mbre      --------------------------NQRRIIITYSCPTTMARDLPQIYTS-----ADAS
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      TW-----------------TAGDRSGSVSITSFCSSCGSNHY------------------
34112_Mbre      --------------------------R-------------TKREIGETYTGKALTYVEEN


N9_Mbre         -------------PGKYRSSSSTL-ATCSSGYYCPHSNCIRYACPAGKYQNQAGQTNCKT
8798_Mbre       --LDGRDGPITSAMS---------------------------------------------
11892_Mbre      -------------PFAWSSWSSC---NCD-------------------------------
22411_Mbre      LTPANRSLPVSYRVNRYRAASEPIRGTYQLGYKGNWTRPLAYSCDAGCALDALIEV----
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------LLPDGLSCNRYR---EP-------------------------------------
34112_Mbre      MFAAQYGMRTTMDIEHY-------------------------------------------


N9_Mbre         CPSSQYQNQLGQTGCRSCSTGYYSPDRTRQVRCPTGSSCNSCSASTCAAGTYQDQAGQTS
8798_Mbre       ------------------------------------------------------------
11892_Mbre      -----------------------------GRRSRSSSKCNTQSEDACTAPSK-SAYGSWS
22411_Mbre      ---SELQ------------------------EISGGSSGNSQDGMTLTFSIYLPTGNLSQ
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ---LQVH------------------------EYFAADHLHLHNIMGIQFELYLNR-----
33995_Mbre      ------------------------------------------------------------
34112_Mbre      -----LV------------------------LI---SDGKSTD------DIVLPARDLRD


N9_Mbre         C---KSCPTGK-------------------YAPGRGYSTCQPCAAGTYQDQRGQTSCKVC
8798_Mbre       ------------------------------------------------------------
11892_Mbre      S---WS--------------------------------CNAACGSGTAARE---------
22411_Mbre      IEVNSSGLTGANVTARAYTQEHGAHELFHEIIPGRYFR-------RFYNDSDGV--VVVT
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ----------SKSMAQAYTN---------------IFF-------DFLHIPDPV--QLEF
33995_Mbre      ------------------------------------------------------------
34112_Mbre      NGI--TIFTIGIISSSTSSSDAAAQRLELRTIAGSEDR-------FFEIESIQF--VSEV


N9_Mbre         TGGVTSTAG--ASSCSACS--PGV--YRTSSTSTA-------------------------
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ---------------RSCI--PGT------------------------------------
22411_Mbre      TNGLRSSCADLGQTSSACAFA--FDAQRNPSINTVSN----------SGDPSV--LAVAD
28702_Mbre      -------------------------------------------VLCA-GKKPKDQPQVL-
33646_Mbre      SEDHSTHFDDEGHSLELHDID--HNVIRPHPIHD---------NGDS-GTDDDDAV-VR-
33995_Mbre      ------------------------------------------------------------
34112_Mbre      VDSLRETLCDAPLTVPCCSGSGSLASANTPSMEILAGGYRYFSPTCADNDVDV--IVVL-


N9_Mbre         --------------------TCTRGSYCPGDCTRTSCPPGTYTSGTGQSACTSCPSGKYA
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ---------------------------CPGSC----------TAGQVDSEE---------
22411_Mbre      IVTISGAGFGLDEAAIAVTFNDIPASIVQVSDTEVICEVPHISAGPINIELIRAHVGRAA
28702_Mbre      Q-----------------------------------------------------------
33646_Mbre      DLGAKADGAGNDDG----------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         TGYANTGCTSYSAVCAAGYFQSRAPTSSSDRVCSPCDGVNNYQDLSGQTSCKVLTRCTST
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      N-HDATAWTYAQ-------------------------AVDAVGPLTGPVAGNLLLNIAGT
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ---DVTAGACLL-------------------------FASIVEPL----PGPLVHNFSDT


N9_Mbre         QYQAVAPTAKSNRQCATCLVARDCAANEYLTGTCNGGTSRTSCKVCDGSCATC-SGPSSS
8798_Mbre       ------------------------------------------------------------
11892_Mbre      -----------------------------------------------------------R
22411_Mbre      GFPASPA--------------------------------ENNVTVGGQPCVVQSAQPDSL
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      SLSAQLS--------------------------------LRIPRGSGDTLFVSVRAPDTS


N9_Mbre         ECL-----------------------------------------------------TCPG
8798_Mbre       ------------------------------------------------------------
11892_Mbre      DCY-----------------------------------------------------VTPY
22411_Mbre      TCI-----------------------------------------------------L-PP
28702_Mbre      ---------------------------S--------------------------------
33646_Mbre      --GRSDDDDDDDEGDDFDEDDDKGPDHGLQRSPKRLRRRRLLEFHGDIHHVKVRYGG-VY
33995_Mbre      ------------------------------------------------------------
34112_Mbre      NCE-----------------------------------------------------A-T-


N9_Mbre         AY-VLNAN------------------------------------KQCVNP-------CPA
8798_Mbre       ------------------------------------------------------------
11892_Mbre      AW----------------------------------------------------------
22411_Mbre      AWSDLDTREADLNGTLNATIVINGEAFTNDFVYDWSLTPVLTAVTPSAIPSAVTTLVTLA
28702_Mbre      ---------VAVSAPAVESGRISMSKVSTNMD----------------------------
33646_Mbre      SWINDWNRIVDMDSPICQAVVADLEPRLNRFG----------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         GTYGTSGNCKNCDSTCATCEA-AGSNACTSCTAPRTLNAATRQCISNCPSGQFHHLQRDE
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ---ATWSPWSSCKSDCGPIVA-AGQQR-------------SRPCVGEC------------
22411_Mbre      GSWPSVGSLDLSGAACAVPAGLAITVAGRACHDATLINATHLTCSFIRADGRAFGEQQGL
28702_Mbre      ----------------------------VEDKPQTDF-----------------DH----
33646_Mbre      ----------------------------YSLKDLTWI-----------------GEP---
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         CVKCDTCDTSEYRSS---------DCTATSDAVCTALSTCAPGTRISRDATATQ------
8798_Mbre       ------------------------------------------------------------
11892_Mbre      --------------------------------VAAGLSKCTPGSV---DAS---------
22411_Mbre      VPRVDFCLTSGNLWRAHTQPTVRVDLNHRVTAISPARFGTAGGARITITGAGFGQLVNS-
28702_Mbre      -------------------MD-----------------------EDAII-----------
33646_Mbre      EPLADLMLKDPYKRRCRNHPIVSAE------------------MKISLSGALFNHIIARL
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         -------N--RLCSPCS-----------------------SGFTSAS-------------
8798_Mbre       ------------------------------------------------------------
11892_Mbre      -------Q--RAC-----------------------------------------------
22411_Mbre      -VGVEAKNVSGSNVPCL-----------------------VDYVSDSQVECVMAEATGEA
28702_Mbre      ------------------------------------------------------------
33646_Mbre      SLSVSLFSVSLSNSLS-----------------------LSNSLSLS-------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ----------------LYFRVDASATLTLVTENLDQTNFVIDYNFDQTYNYEI------A


N9_Mbre         ------------------------------------------NSDECAPWTVCSPGEY--
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------GGASWNPWNIASPCSQ--
22411_Mbre      HDCELELQINGFVARCSPG-----------------------------------------
28702_Mbre      ------------------------------------------------------------
33646_Mbre      --LSLSLSLSLSLSLCSPLDPSPSLKLSLKLALLKTLSFSVSGSLALSSFSLHSFCLSLL
33995_Mbre      ------------------------------------------------------------
34112_Mbre      RPRWTSVNINGFDSSFNIG-----------------------------------------


N9_Mbre         --------------------------------VTKQE----------------------T
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      ------------------------------TCVVDFLSNLTAAILPSTERPSVGWGDVVT
28702_Mbre      ------------------------------------------------------------
33646_Mbre      CLSLKLSLSNSLSQTLSLKLSFLSLSLSLDKDVPL---YYWSDFCAPPDL----------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ------------------------------REVSYLVTNYSNVFSTKSDT----------


N9_Mbre         SSTDR---------------------TCGTCAAGKYTDGQNAVQCSQCPAGTYQGS--K-
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      LTTERVWGNPSVTVGGVPAVVQSYSETAVTFEVPALSAGAHDVALAVAPYGRASGMASLG
28702_Mbre      ------------------------------------------------------------
33646_Mbre      --------------------------------------RGCLVKCRLGPVGLQQ------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      --------------------------------------GRVSVGTALTPYAG--------


N9_Mbre         ----------------GAAICTECGAGMYSSAGSTSCTAIPAGSYGT---GGTSSTRTGI
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ---------------------STCGSGQQTWSRSCSLD-------GT---EQE-------
22411_Mbre      YRLSVDGLSQLSGSVAGGSRVVLVGEGFPTDPTALAVSFVHAGSGNNARRAAVLSTNMTL
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ----------------------QTGAMMRSSKRKSSM-----------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ---------------------------------------------------------QFL


N9_Mbre         SPCPVGYACPGGDYQPQEC-------------SSISQYQ-D--QSGRATCKSASDCSLGE
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      AEVVIPYLINEGTAHSETYELALTVTNSSTFQISVADAA-DLATVAAANCTNPQACAFFY
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------KGMNPAFI-TAIDEHS---------------ISAPY
33995_Mbre      ------------------------------------------------------------
34112_Mbre      --------------------STTFKAERTDFV-CVYAEQDLSMTV---------------


N9_Mbre         YASNDPTTTTDRRCTA--------CPANTFQ--DDP---------EHVD-EACEPV----
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      NASETPVLTAIQPTTGAAGTVLTLTGSNFFA--EPR---------VHIAGVACTVLTANS
28702_Mbre      ------------------------------------------------------------
33646_Mbre      YLQNQTASHVQEQL--------EGLPDGTFYIYDDGKGHNFYLCYRHAEQT------KTA
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         --TVCKPGEFV--------------------DTAATKTSDTVCSACPNENS---------
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      SLVTCTVGEVRGGSHLVEVEVTPFGMAMGIHTFAATATVDSMS---PAIASYAGGTLVTL
28702_Mbre      ------------------------------------------------------------
33646_Mbre      TISATAEGVFI--------------------STSTEKFGSLIE-----------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         --------------------------YANADTNKPPLPPPTALARPAPPTPSRTSPISPS
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      HGHGFGPADAVSITVGTKSCDVVNTTYNQVLCRAPEVLTPLAVAYYAHVEP---------
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         VCPCKVVPQAVAPTRTSDRACATCAAGSFQNNVDHEEAACSAWRDCGAGSYVSTPGTLTS
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      ----VVLPGTMSYEQLLDRDYSTYVSNCCNREVDFALPED-------------QAAVLTR
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         DRQCSACSSDQYQDQSNQAACKDVPEGYYRVSAKEIAQCDVGYRCTGGQAMRCVTGDTYQ
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      V---RFFPRLKYESRSAGGQFYASPNGTHWVLIAEIADYHAGWNSID-------------
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         DQQGQSVCKNVTHCSY-------------GTYASQLPTEIRDAICTTCPAGFFNDDIDHF
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      ----VSVDFPVTHIRYTNERIDMAEFEFQGHVVEQAMDEALPVVTRIHPAALPNSMVVHD
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      --------------------------------------KSLPT-----------------


N9_Mbre         DTACSKMRDCVAGQYVLAAGTSSTDRSCEGCDPDDTSSAREAGFSNTTNSASCTPLSLCP
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      AATA----------------------------PGPADAYIAPGVQNLTYATAQTPEV---
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ---------CMDGESLLAAGTPTSDRVCETLV----------------------------
34112_Mbre      -------------------------------------------------TTTTTTTT---


N9_Mbre         AGKAV-NSAGSATADRTCTACSPGNSYMATDQHSETECVPVSAPCDVGMYESKNATLTSD
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ---------------------------------------SDSRPCVSGAPA---------
22411_Mbre      --NAIRPTWGTALGGTKITVLGLGLTAVSSVTINTYPCSDISVVS------DSLITCVTT
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      --TTTTTTTTTTTTTTTTTTTTTTT-TTTTTTTTTTTTTTTTTTT------TTTTTTTTT


N9_Mbre         RECTACATGTFQ-DVSD-----------QASCKPWSDCPVGSYIENDGTKTSDRVCQTCD
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      RRSTLTALSVEV-EVDDGSIAVNQPTARFRYMDRWSQ--VNTWVNDEPPIEGDTVVIPAD
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      KRRYVPANTTEATSTTLGIIAVAQPSPKN-----------------------DNLWFLL-


N9_Mbre         GVTNYGDVKNLQQCKAMSVCPVGTQYIKVEGT----------------------------
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      QV------------VLMDVTPPKLFLLLVQGQLIFEDMQDLELHASYIWVQGGLLEVGTE
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      -L------------L-------LLLLLLIP------------------------------


N9_Mbre         -------PTTDL------------ECATCLHESDCADGEYLA--GQCKHLNAPYCADCHP
8798_Mbre       ------------------------------------------------------------
11892_Mbre      -----------------------------TWSPWSPRLECATPSAQGKS-HRPWLRDCQT
22411_Mbre      DVPFQHRATITLYGDRWNSIGLPHLGAKCLVATNAANYMGLY--GGHDGAAVP-------
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         KCE-TCSGPLD---TECKSCPEGTHLEHGQCVTECSYGKYSAGGTCTDCDDSCADCDGLG
8798_Mbre       ------------------------------------------------------------
11892_Mbre      NCHGNC------------------------------------------------------
22411_Mbre      -----------------------------------------------ATLR---------
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      -QE-NCSRPLLSDSSYCIQCPPGLLLVDGVCSNT--------------------------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         YRCTDCAAPKVLDVSTQTCKDTCPARFY---VNRTSRVCVNCEPCG--------------
8798_Mbre       ------------------------------------------------------------
11892_Mbre      --------------------------------------------SG--------------
22411_Mbre      ---------------------------------------------GVIDIHGIPRRRTWT
28702_Mbre      ------------------------------------------------------------
33646_Mbre      --------------------------------------------------LVCYYSNANA
33995_Mbre      ----CPDELPILDTYTQTCRLCRAGHFGASCVACSND-----------------------
34112_Mbre      --------------------------------------------------CCIYYRRTHQ


N9_Mbre         ------------------------EDEFTTTQCTHSS---NRQCTVMSTCPVGTYISVGG
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------DAL----RSGPCT---WSTLTI------GARVNASL
22411_Mbre      KVAQTVAIGDTQIFLSEEVDFAPGETIIL---TSHTNYKQT-------------EELVVA
28702_Mbre      ----NARMDAKTAT----------------------------------------------
33646_Mbre      DLPVRLQLDPKTLK----------------------------------------------
33995_Mbre      ----------------------------------------DC---LYC------------
34112_Mbre      KINVSAALEDPPIV----------------------------------------------


N9_Mbre         TESNDRECEACSSSTQYQDQ----------------------------------------
8798_Mbre       ------------------------------------------------------------
11892_Mbre      DGAQRRRGDEHTASEVFAQW----------------------------------------
22411_Mbre      ARSVDNRVLTVTSPVQYEHQSFFYEAAGERVDMRIEVGLISRNIVVQGEPGASEKQNFGS
28702_Mbre      -----------------------------------------------MAG----------
33646_Mbre      -----------------------------------------------KAPKVS--KNRAK
33995_Mbre      ------DPSNS-------------------------------------------------
34112_Mbre      -----------------------------------------------PAPLGA--PQLPM


N9_Mbre         ----------------------------------------------------------VN
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ----------------------------------------------------------VS
22411_Mbre      HLMAARGAMLRL--ENAELRRCGQAGVLGRYCSHFHLGGSLPDSYIKSNSIHHSFQRAVT
28702_Mbre      ------------------------------------------------------------
33646_Mbre      SLEKFRKAQERE--EKKREQARLKAGFPARYSV---------------------------
33995_Mbre      -------------------------------------TICTQ------------------
34112_Mbre      SPRPFAGASSSAPTATRRETP--------RTVL---------------------------


N9_Mbre         RN-SCKTLRNCDVGHYVTV----------------AGTVSSQRECGVCA-----------
8798_Mbre       ------------------------------------------------------------
11892_Mbre      QS-IL-------------------------------------------------------
22411_Mbre      VHGTHNALVQNNVAYFVKGHTIFVEDGDEFFNVIDANLVARTEKLHVMLKGDQKPASFWM
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         --------------------------PGTYSGSSNSAVCEPCAKGYGQPEHGQSS----C
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      ASPSNLWRNNVAAGCVNDGFWFELPSN----------------------PHGPSYTTSIC
28702_Mbre      ------------------------------------------------------------
33646_Mbre      --------------------------P----------------------NHGASCLLTRC
33995_Mbre      ---------------------------CYYDDALSNGQCELNANTYNAPFYGSDV----N
34112_Mbre      --------------------------P----------------------QSGAGSKM---


N9_Mbre         TECG-VGAFQNQTGQATCMKIPSSYFGVGGGPRTRTDIQYCEPGYGCPGGTTTRIMCDGI
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ----------QW---------LAI-NNGTLPATQLGRLD---QGW---LVGDQLTRGD--
22411_Mbre      PVHGHLIEFRNNTAHANG---------VHGLRIYPV------------------------
28702_Mbre      ------------------------------------------------------------
33646_Mbre      PL------FSN-------------------------------------------------
33995_Mbre      GPLI-MAAIVEA---------LSSSSNLAIRARSYTDIT---DG-----VVAELTMCDRT
34112_Mbre      ------------------------------------------------------------


N9_Mbre         --STYQDQAGQVSCKTVTLCQAGEFASV-----------------------QATRTSDRV
8798_Mbre       ------------------------------------------------------------
11892_Mbre      -----EAMPEEVEVQAQLT-VIGEFGHAFMLAFGGTEGRNITLPLVCPSNVS-ELMGANV
22411_Mbre      -----------------------------------------YLPYVDPCDES-SGPAPQ-
28702_Mbre      ------------------------------------------------------------
33646_Mbre      -----------------------------------------PLPHSAPEQGA-ELPGAQL
33995_Mbre      TFK----------------C--YSDAEV-----------------------EAVLTSDNV
34112_Mbre      -----------------------------------------PVVHSLAAAVP-QAPARSS


N9_Mbre         CSA---------------------------------------------------------
8798_Mbre       ------------------------------------------------------------
11892_Mbre      QAV---------------------------------------------------------
22411_Mbre      -YYHNFTTFNNGEHGIFGKENGDLHHINVKSVGNGREEIFWTKLHDVEYRENDPHIVNSL
28702_Mbre      ------------------------------------------------------------
33646_Mbre      TVAHIVTWL---------------------------------------------------
33995_Mbre      TAV---------------------------------------------------------
34112_Mbre      SRAQPSATF---------------------------------------------------


N9_Mbre         CAPGFYMDRYAHTETKCKPHTVC----------QPGTFTAAPGTNYTD------------
8798_Mbre       ------------------------------------------------------------
11892_Mbre      TVV-------------RLYVAVP----------PPTTLDPAMTTKGAAASQDRKNKASMI
22411_Mbre      FVNHVDPSRPAHTV--------GLFMPQNEYFHVAGAKFVNYGAKGTL------------
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ---------------------------KNEGMGEYAG-----------------------
33995_Mbre      LD--------------ALNVTMV----------QPTTTTAAPNSS-DLASWLRRNRTIII
34112_Mbre      ---------------------------MNPTFNADAA-----------------------


N9_Mbre         -------------TICAACDGQTGYSDEAGL---GDCKPISSCEPGEYVSRTPSSTRPRQ
8798_Mbre       ------------------------------------------------------------
11892_Mbre      VPIVVAVMALVLIVVVVVYRRSTRGRKPLVA-P-DTVPM---SSNPLYGDE---------
22411_Mbre      -------------SACAKCDTQTNFR----------------------------------
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      IVCIVLFIIILAIVLYLICRNQGNGPKETKLNFDLRRKK---SSNSLEIVR---------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         CTDCDTGKYSA-TVNAADCVAVTDCMPGTRILAEATLARDRVCTNCIS-GSSYSN-TKNA
8798_Mbre       ------------------------------------------------------------
11892_Mbre      -----TLGSTE-ME----------------------------DRSTAS-ATAQPN-YNHL
22411_Mbre      ---------------------------------------QGGYTFRLQ-GLEFFNSTKRA
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      -----TGGYSDDFL----------------------------ERNYAALAWYQ-------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         EECTAATLCASGEIQSVAATLTSDRSCSGCPVGSFSGNANNQDTQ------------CQP
8798_Mbre       ------------------------------------------------------------
11892_Mbre      QHPT-----------------------------GAQASYDRLDGA------------TDP
22411_Mbre      -EWTSPFKQIF----------------------------YDLDGS---------------
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ----------------------------------------NFKKQKVDGVRLLALTEDDL
33995_Mbre      QN------------------------------EFFRASGVDMDGN------------AQP
34112_Mbre      ----------------------------------------NVPPRTVPSVAPLPLPPSQP


N9_Mbre         WKH--CAAGT------------------YEHAAG--TSSSDRVCSKCPSHQFQDEANQQS
8798_Mbre       ------------------------------------------------------------
11892_Mbre      AISTVHSYNG------------------LSHQHG--LVDDY---------GNPIEQGDM-
22411_Mbre      -LTGFVNGTA------------------------------------TPFHAFN-------
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ARLGV----SFPQHRQQIMRAIDKLRRRFEAEAAGIDVEAE-----AAQQAAQ-------
33995_Mbre      WMMGIVSARR------------------VEFLLG--NQTDGAFCVRV-------------
34112_Mbre      HFIAVRER----------------------------------------------------


N9_Mbre         CKDCSEGYYAVSAAEQKICPAGSACDSCERSACSLRESFTSEQGTTACVPVIPCTVGQRI
8798_Mbre       ------------------------------------------------------------
11892_Mbre      --PPEY------------------------------------------------------
22411_Mbre      ------HYPGVCDAMGEAYDFGLVCDNTVRV-----------------------------
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------PQP-LIPEPEEGKAIGVIGRNINGV-----------------------------
33995_Mbre      ----------------SAHNLCLVLNV-------------SWNG----------SV----
34112_Mbre      ----------------------------RRV-----------------------------


N9_Mbre         VSMPTLTSQAQCTAC------DDGTYNDDASN--------------FDLTCKPHSVCVPG
8798_Mbre       ------------------------------------------------------------
11892_Mbre      -----------------------------------------------------------G
22411_Mbre      -------RRLQIDAI------EPDELDDQALR--------------LAQVANASRSGTIG
28702_Mbre      ------------------------------------------------------------
33646_Mbre      -------IR-LFDEE------TNEEIDDLEK----------------------------H
33995_Mbre      -------W--HFPIE------MDDELDEMEH----------------------------G
34112_Mbre      -------RHVAIEVSDDAYFLDPKMSDDYPFQQPRFGYLPDLVAHYA---APVPRPGLRW


N9_Mbre         EYVSEVA-----TATSDRECDACSGGFSAVNNAASCTDFRTCGKGEVEISEPTRT-TDRQ
8798_Mbre       ------------------------------------------------------------
11892_Mbre      EAVHEYG------------------T----------------------------------
22411_Mbre      YRVKEIGG-WVAPVVNNREYDL---------GLVSLIDFRSM---------RIRY-SER-
28702_Mbre      ------------------------------------------------------------
33646_Mbre      Q--------------------------------------AAM---------RARI-AQA-
33995_Mbre      YRIYEVGTDFFFPT------------------LESMIDY--------HMQEPLLNNVLLT
34112_Mbre      ------------------------------------------------------------


N9_Mbre         CSSCELGVTYMDDVDHTRDTCVPVSPPCAPGEYQFSAPTISSDRVCLNCPTGKYTDSSDQ
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      -----HYLQYDDEL------------------------------LLLNFNYTDYRYDFEV
28702_Mbre      ------------------------------------------------------------
33646_Mbre      -----KLAAYNDDF----------------------------------------YASREA
33995_Mbre      YAVCDGGMSFWKLIDYVREL-----------------------------------DASDT
34112_Mbre      --------ALRDEL------------------------------GGLQPSFRSY------


N9_Mbre         SSCAANVVCPIGSVYA----TAATRTQRGTCRS------------CDGETHYSDEGNATA
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      VVGDAAVEQPSVSLID----TLGATSAYGTGRI------------VPNEKHWSVALTARP
28702_Mbre      ------------------------------------------------------------
33646_Mbre      VVPPPAQAPPVIEDLDMYDAVQSKDAQFGFGQA------------ET-------------
33995_Mbre      ESQ--------GPYYP----D--GRTRRSTVFSIGRSSVGSFVMHN--------------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         CKQTTVCPSGSYVVVEATASSDRQCEVCLTADDCATSQFLSGQCRSEAPPTCVACHA-SC
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      ADP------------------------------------------WDSNPFMLVTHAIQC
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ----------------------------------------------SLPPPALAPRG-AA
33995_Mbre      ---------------------------------------------SDGAPTTVHARG-SA
34112_Mbre      ------------------------------------------------------------


N9_Mbre         ATCDGPAATDCLTCPESTNFDNGECVSSCDDGDYEDTTQQCRSCDASC------------
8798_Mbre       ------------------------------------------------------------
11892_Mbre      --VDAP------------------------------------------------------
22411_Mbre      APGRCGFFTD---------------LPLYDPTLWTETKYWCRNSVTKSATYARWYSAEFT
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ARFQEPMG---------------------------------------------------G
33995_Mbre      ------------------------------------------------------------
34112_Mbre      --------QR---------------TPLYDVPLT--------------------------


N9_Mbre         --ATCDGPGPNN----------------CLSCPADTHLDLNAKRCVDACTSGFYKDATTK
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      SEPSCDGDHTLPLAGDQVEIGVRMYVVMNINPPAFSHMDIAGKLQFDDSDDRMLE-ANTI
28702_Mbre      ------------------------------------------------------------
33646_Mbre      DSSTDDGPASLPPRRGTVDNTAPP------------------------------------
33995_Mbre      TYHRPDYPSPRR----------------------------SSA------MQGFRQDSQGS
34112_Mbre      ----------------------------------------ASSAQLSDK-DKLAD-LVEM


N9_Mbre         SC---VQCTSCGTGAYASAACTATSDASCTPWSTCTAGQYVTGNPDSVQDRTCANCDGTT
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      SVWGELQVGSSGKP--------FEHEGVVRLHGQRTSDSLIIDDTHFLGNKVMA-VLGTV
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      F---GRRHTNASIRSLTHTIYESAEENGASPSSTGTSVVLIP------------------
34112_Mbre      AVMG--------------------------------------------------------


N9_Mbre         RYQDQINQASCKVPTSCDPGHSVSADVTTTTDRE--CQICAAGSYADA-ANAESCAPCPA
8798_Mbre       ----------------------------------------IYAAVVDE-SDTYI------
11892_Mbre      ----------------LKPEHGI-------------------HSYGDPQLKARGNAYHPY
22411_Mbre      SMYGQPRTAWVRLAATAMPGD-LAFNVTSPVDWVSGDEIVISSTEYDA-SETETHTVA--
28702_Mbre      ------------------------------------------------------------
33646_Mbre      -----------PVPVSNRPPP-L-----PTSDR--PGS----------------------
33995_Mbre      ------------------------------ES--RLVEQDSTGSHASSA-YSEAMD----
34112_Mbre      ----QLIDECI-------------------------------------------------


N9_Mbre         GHVQPEQGQSTCRNCGPGTYQAQTGQTSCVTIP---AGSYGIGGTVATRTGSAVCAKGFA
8798_Mbre       ------------------------------------------------------------
11892_Mbre      GTPMP-LGNSTASTAPPGYSADNHAYDTPVPLP---KKTR--------------------
22411_Mbre      ---------------------AVSTDGLMVTMTSAMAHRHFAGDIDGGAQGTQFLAAAVG
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      --MEPHEG----------------------------------------------------
34112_Mbre      ---------------------------------ELEVTRHFAQR----------------


N9_Mbre         CLGREHAPQACDGVNTYQD---------EIGQTACKRISTCGQGQYASSAPTTTSDRVCS
8798_Mbre       ------------------------------------------------------------
11892_Mbre      -------------------------------------------GAFASGSVVSNAGYVDT
22411_Mbre      LLNRNVRFEGAEGANEGSN---------YGAHVVAMDVNIDGNVKVASTEFSDVEFRSCG
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ---------------ETSLYDSLFESIVD-----------DANLT---------------


N9_Mbre         ACP--------------------DGEFQSLALHMQASCTA-----------H---TVCQP
8798_Mbre       ------------------------------------------------------------
11892_Mbre      SFP---------FDKVQSAL--DA------------------------------------
22411_Mbre      QQNMEHACIFYKYDRSYTAANSPSNVLHNSVLHNSNNYGI-----------E---TEGAP
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      --------------------FAEMDVLHESVNHA-----VLMSLTNIEEQLYVEGVDEAP


N9_Mbre         GQFVISDGTAVVDRRCGECNGIDEFSTTTNAASCQAVADCA-AGTYVTESP---------
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ----------------------D------------------------YDVP---------
22411_Mbre      N---------------------------------VTITDSVIHRTYRSALKLDATTMRFV
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      --------------------------------------------TARSAMPQDPNSL---
34112_Mbre      ----------------------------------IGVTDTV-ENDYETPMP---------


N9_Mbre         ----SATENR-QCAACPNGKYSESTNQDACIDWQDCAAGNYVQVNGTTTTDRECEPCDYG
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ----EAVRRQ-AQTSFPFDKVQSA--LDANYDVPDA---VRQQTRKTAV-----------
22411_Mbre      MTGSLVVDNR-R-------------SPDASTDWVVPYAGLYAETYSVTLRDNV-------
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ----TLIARTSPRGADAAAHEEAES--DLGAE-----------------PETEGEGCKPR
34112_Mbre      ----SDMQYR-Q-------------GNA--------------------------------


N9_Mbre         VDFSTSTNAMA-CTPVQD-CQMGQRETVSPTRVRGRTCEPCSEGTYMDLSDHDRTRCKAV
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      --FAGMTDTGMMIRP-NS-CGDADRATIT---------------------------NNEV
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      KTPSSSSRPR----ATRR-LSIGQRTTARSSK-SNSLHSPSESLTSLDMTDD--------
34112_Mbre      -----------YLEP-VVLADTGSEITLT---------------------------CDEN


N9_Mbre         STCTPGTFVSVDATISSDRVCVACPSAAFSTGENVEACTLWR---TCGAGQYEQEDPSPT
8798_Mbre       ----EGPFNNP-------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      HSTLVGVFLMADAKSCF----------------ELRGATVWK---AAHLG----------
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      YASVFGTFLDPQQQATA-------------------SEAVLAALMAAGID---------I


N9_Mbre         NDRVCVDCAAGTYMDKSSHSDSTCSAVSSCPAGTFIRQAATLEANVICAACDGVTGYSSE
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      --IVTVDQRA--------------------------------------------------
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      --------------------------HAM-------------------------------
34112_Mbre      SDLTSVEFEA--------------------------------------------------


N9_Mbre         ENQAACTPVSDCGPGAYIS--RTATTTSDVQCRNCTSECLPTQFLTGTCGGDEGTANPTC
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      EVQILNSVVSDSHIGISLNFFTIAKRGSEVLIENS-------------------------
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      GSIRIKIEAGDKTRE---------------------------------------------


N9_Mbre         VDCHPTCATCSGRSKSQCLTCAGNLIYDEGTCMTTCSDPHDYPTGGAGSACAACDDSCGT
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      -------------------------LIMGATAASTCDDS------------LRCRAVTGT
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         CVGPSANNCTSCEGNLHLSPDFACVAHCPSGYFDNTDDNRCEVCATCTSGT--WASTPCA
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      DVQGTGSTCGSVFGNSYR-----------------------HVGVVLPQYT--NRGKTCE
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ---------------------------------------------------IK-------
33995_Mbre      ---------------------------------------------PTRPGRVKSQSSSQK
34112_Mbre      -----------------------------------------AIARAVRDGRLNFQLPYSA


N9_Mbre         QDAQTVCSAWSPCAIGEEQSTAPTPTSDRQCAACPEGFYQD---EAGQLTCKTVSLCNSP
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      QDYLPSCRPVT--------------RPERLCGMGWEARYGLPSVTHAHITMRDVTFAHFN
28702_Mbre      ------------------------------------------------------------
33646_Mbre      -R--------A------------------PLPA---------------------------
33995_Mbre      VTPPSRSSVH--------------------------------------------------
34112_Mbre      QRGPSRSTAWQ------------------PLDAAQW--FAWYQ-----------------


N9_Mbre         DVEVVAATPSSDRVCDCDYAACVDRINNIFEDHMCRAPAPAEMDYYVNNSLIGCCTGRLE
8798_Mbre       ---------------------------------NGQAHSR--------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      -----------------NRSSCNLKSYGILTNPTQRNYAP--------------------
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         AEQINDISKSDTYAERHDCDGCQRG-LCSCVDGYVETNTTFVISQSDIAEADEVA-TTDS
8798_Mbre       AP----------------------------------------------VAVAPAQYTGIL
11892_Mbre      ------------------------------------------------------------
22411_Mbre      EQQYTDVTFYETDAERRFYFGRLPEHSSECQTGCD--ALTYLLAHESNGELSGLSGAGTI
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         SATVAPATVFGT---------TCQRCPADTYKPSHTNQCVQQTVCHPGQYEAVAASITSA
8798_Mbre       TE----------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      TSNVNPGVILGEPFCTSLPSNGASRCGSDSMRLRHAV-----------------------
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         RVCTTCNFDAETDDDANPLTPCVPVIKCTADQWEQFAPTVTSNRVCRADFPVAVNFAA--
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------------
22411_Mbre      ------LINRDRDSGFRRIGP-VNVQRMKADGVN------ATERVTSSEGPFSDNCAKRF
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         -------------DYDTFFGNDNMTTNRTLEFLSAFRGRV----ARGYMSKYG-------
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ----------------------AQRQDEPSEDAYDVPAMV----YRRG-A----------
22411_Mbre      YFGQHPFVIDAAHNIFKVNTSNDFPANARIEFVGQDVNDRAHLKIRVYVTNLDMRLVHNG
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         -----------------------------------------------VRVN---QSDIDQ
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ------------------------------------------------------DQEGEN
22411_Mbre      VEKEPLGAIPDVNVHPVGTYTFDARNTFHLIVGGTGHHIFDIRTLSIVRLNLTVTMSLDE
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      --------------------------------------------PTIVR-----------


N9_Mbre         FFEPDTSVSRGPVL------------------STARRAATHAITVT--------------
8798_Mbre       ----------------------------------------------------DSTTANRE
11892_Mbre      EYDAPRQLVKQAKS------------------S------SLKASYD--------------
22411_Mbre      FFDPSQIVSNLAILLDIPSSRIKVVGVHDTASADARRRATGSKVLALAIGDQDNGTSTVP
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ---------------------------------------------------PPSPAAAPA
33995_Mbre      ----------------------------------------------------HRAAAETT
34112_Mbre      ----------------------------WEATEMLRHQPEGSFVVYMRQEQRDVGAAEVD


N9_Mbre         ---------------------VFSS-NGTIQTLIVEMSMNGTLIVDGLEAWPCSAGFDYY
8798_Mbre       PLPPRRSRPPA-------------------------------------------------
11892_Mbre      ---------------------VPISPLTASED-PSYYLATTTTAPQRMYSAP--------
22411_Mbre      TTDEEEENQNNLLDELMNNITAVVT-SGALKTKL---NESGVRLDGVTMAAPASAGLE--
28702_Mbre      ------------------------------------------------------------
33646_Mbre      TPPPREGRPPA-------------------------------------------------
33995_Mbre      PLQVPFAMTPNSTP----------------------------------------------
34112_Mbre      ELDPPEEREPA-------------------------------------------------


N9_Mbre         VEALSTTPGYPAECTEYSECVINEFEEYAPTTTTDRICAQFKRACDTDEVELAAPTATTD
8798_Mbre       ------------------------------------------------------------
11892_Mbre      ----------------------------------------------------EGE-----
22411_Mbre      --ASR-------------------------------------------------------
28702_Mbre      ------------------------------------------------------------
33646_Mbre      ------------------------------------------------------------
33995_Mbre      ------------------------------------------------------------
34112_Mbre      ------------------------------------------------------------


N9_Mbre         RLC---------------------------------------GPPEVD--------ESTG
8798_Mbre       ---APPVTAQRPP