Protein (view, download) , Domain (view, download)
DDB0216398_Ddis  MRPLP-------------------------------------------------------
DDB0229384_Ddis  MEPTYS------------------------------------------------------
SWE1_Scer        MSSLDED------------------------------------EEDFEMLDT--------
CC1G_01961_Ccin  MSPTYHCTPPRRCADTVRPFDSPMLTPSPLRQPTIFSPKFNNDAQDIDDLFRNSPYRSPA
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       MCSFALT---------------------ILHT----------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       MPFAG-------------------------------------------------------


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ---------------------------------------IPSTPLK-TPIRITVNNGHNS
SWE1_Scer        -----ENLQFMGKKMFGKQAGEDESDDF------AIGGSTPTNKLKFYPYSNNKL-TRST
CC1G_01961_Ccin  QAHIFQNPAY-STKPLPIQADDEEGRIFLSSNSNSPRLSSPTSQPIFTPLKSPYN---TA
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       ------------------------------------------------------------


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  GQHSL-------------------------------------------------------
SWE1_Scer        GTLNL--SLSNTALSEANS-----------------------------------------
CC1G_01961_Ccin  GRVALADRNLNEPQPIA-TSSNGPMLTSRAGIGTKRKVTPQCTPLKIEASGSFQKLGPLP
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       -----------RSVFFCSS-----------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       ------------------------------------------------------------


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        --KFLGKIEEEEEE-----------------------------------EEEGKDEESVD
CC1G_01961_Ccin  APKFATKTPHSKAEAEEFLRKQTATLTKLKLSDRDNRMDTSNDSDCDFDEEAGANLFRTA
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       --LYVLFLDEYLNQ-----------------------------------EAEN-------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       ------------------------------------------------------------


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ---------------------------------------------------------SLS
SWE1_Scer        SRIKRWSPFHENESVTTPITKRSAEKTNSPISLKQWNQRWF----PKNDARTENTSSSSS
CC1G_01961_Ccin  SKGKEKEEVVEAVSPGGRVVKRRAR--TRPLSAELRNQQPFESPSPVKKPFLSKTRPRHS
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ---------AKTL------------------SLRQR----VMSP----------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       ------------------------------------------------------------


DDB0216398_Ddis  ------DQSAFEDKSELVSKKQKNEDENN---E---------------------------
DDB0229384_Ddis  TCKPTPEQNAFNL--NMFSEKKKNQY--Q---T---------------------------
SWE1_Scer        YSVAKPNQSAFTSS-GLVSKMSMDTS--LYPAK---------------------------
CC1G_01961_Ccin  GTIAFPSSNAYRSR-ASPSGSSSSEA--GSPAPRRRISNVASRPYIKPPVFAPRPPISRQ
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       -------------------------------------------------------P----
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       -------SA--H--PPILQQK-GP--AKQ---K---------------------------


DDB0216398_Ddis  -----------NRSP-ETPRTPKVCPK---------------TPTKTPL-----------
DDB0229384_Ddis  -----------PKCP-SPPLKSTPASR---------------VNSNLPL-----------
SWE1_Scer        -----------LRIP-ETPVKKSPLVE---------------GRDHK-------------
CC1G_01961_Ccin  DNLSAATLFFGPVIPQSAPLQ-SPARTRTTTSTGIPNPDIKSARSKAPNRHSYGGTGTSG
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       -------------CF-RNPFVN-------------------------SD-----------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       -----------MQRP-ETPLGASMARR---------------TCMEGSL-----------


DDB0216398_Ddis  -RT---------PTK---------------------------------------------
DDB0229384_Ddis  -IHHISSLSMFSPTTSLSDFM---------------------------------------
SWE1_Scer        -HVHLSSSKNASSSLSVSPLN---------------------------------------
CC1G_01961_Ccin  DWAHIAHPSSPSPMYGVPPAAQRDNSYISTDEDEEMSFEGPAQSSFTFSLTGSTPSPSSK
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       -V----------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       -VY---------LDK---------------------------------------------


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ----------------------NCE-NGGSNNIDFSSSFGSSSLNSNNTLSINNNNN---
SWE1_Scer        ----------------------FVEDNNLQEDLLFSDSPSSKALPSIHVPTIDS------
CC1G_01961_Ccin  KPLPRKFESIKRRSLGDYEMSVSRP-YGGSLAVMPGASTSSSSLGSDDGLITPLTTAPTN
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       ------------------------------------------------------------


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  WPGPQVHDKDSDDHRPRFTDDEAEVDEFIVRTLAAATKGPAPGSKRPPGTPVKKVRTAFL
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       ------------------------------------------------------------


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  GPDRPWQSAVASKIGIKEDVAPLRTRKIPRQSMPAVMPMGGKSLLDQCTDTEDEEDSPSA
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       ------------------------------------------------------------


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------SPLSEAKYHAHD
CC1G_01961_Ccin  KKDSRYTKLGLGHPVGLFGGSGPFANPRTRWLMRRSSSGAFSSGSETTS-----------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       ------------------------------------------------------------


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        RHNNQTNILSPTNSLVTNSSPQTLHSNKFKKIKRARNSVILKNRELTNSLQQFKDDLYGT
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       ------------------------------------------------------------


DDB0216398_Ddis  ------------------------------------------NQ----------------
DDB0229384_Ddis  ---------------------------------------NNNNNGGYK------------
SWE1_Scer        DENFPPPIIISSHHSTRKNPQPYQFRGRYDNDTDEEISTPTRRKSIIG------------
CC1G_01961_Ccin  -----------------------------------QANTPTRTKGIDWQLPKLAANLSPS
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       --------------------------------------FPERAR----------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       ------------------------------------------S-----------------


DDB0216398_Ddis  ---------------AG---------------------------------------VQFL
DDB0229384_Ddis  --IPSSVNKNSNNYNSN---------------------------------------SNSN
SWE1_Scer        --ATS------QTHRESRPLSLSSAIVTNTTSAETHSISSTDSSPLNSKR--RLISSNKL
CC1G_01961_Ccin  GTFSK------LTERSASGSSTSSGVASSPTNRKGGSTRGTDVKPPRVSLVNRRL--SEP
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       --------------------------------------------------------QGCV
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       ---------------TN---------------------------------------IKS-


DDB0216398_Ddis  TQKKRTKSCSSHFEYINQIGEGSFAKVYKARSF--VDGRLYAVKKSKKPIWETSERNQ--
DDB0229384_Ddis  SSNNVISLFDKNFDVVCKLGSGSFSDVFKVKSK--FDGNSYAIKQARHQFRGFQERER--
SWE1_Scer        SANP-DSHLFEKFTNVHSIGKGQFSTVYQVTFA--QTNKKYAIKAIKPNKYNS--LKRIL
CC1G_01961_Ccin  SLTEQSGRFERDFVTVDEVGSGEFGSVIKVRSKGGDENKVYAIKRSKRFE-GAKHRLRLW
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       --------------------------VYEARDR--RHGVLCAVKISKQPFFAREDRER--
WEE-S1_e_Smoe    --------YREEFHQIKEIGQGDFSYVYKVLKR--LDGCLYAVKHSNRHQLNEGD-----
WEE-S1_f_Smoe    ---------------------GNFSYVYKVLKR--LDGCLYSVKHSNWHLLNEGDQRK--
WEE-S1_b_Smoe    ----------------QEIGRGDFSYVYEVLKR--LDGCLYAVKHSNRRLLNEGDRRK--
WEE_a_Smoe       SAFGSSSRYREEFHQIKEIGRGDFSYVYKVLKR--LDGCLYAVKHSNRRLLNEGDRRK--
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ----------------------DFSYVYKVLKR--LDGCLYAVKHSNRRLLNEGD-QK--
GK074_Glam       MQRVNHSIIMANYTVLEILGQGCSGKTYKVLFQ--RDGRLYAMKKKRSATS--EDVKE--


DDB0216398_Ddis  -------HIQEIENGMK--LGHHNNIAQVMCAWEEGGHIFIQMELCERGNLKDALNLAVQ
DDB0229384_Ddis  -------AVREVKAAVS--LPPHTNVLQYYSSWEQNNTLFIQTELCENGSLQDFLDSLSP
SWE1_Scer        LEIK---ILNEVTNQITMDQEGKEYIIDYISSWKFQNSYYIMTELCENGNLDGFLQEQVI
CC1G_01961_Ccin  EEVEVLKHLSESAELCGL-DGRHPNVLAYIDSWEEDEALFIQTELCESGNLAHFLWE-YG
WEE-S1_g_Smoe    -------------------------------SWFENDFLYIQMELCETN-LQDES--L--
WEE-S1_c_Smoe    ----------------------HENVVRYFSSWFKNDFLYIQMELCE-------------
WEE_b_Smoe       -------FLREIQSVAC--LPEHPNVVKYYRGWQQDAHFHIQMELCDGGSLRNYLDAL--
WEE-S1_e_Smoe    -----------IQETML--PGYHENVMCYFSSWFENDFLYIQMELCKMN-----------
WEE-S1_f_Smoe    -------ALREVQALLC--LSCHENVVHYFSLWFKNDFLYIQIELYES---------L--
WEE-S1_b_Smoe    -------ALREVQALSC--LGYHENVVRYFSSWFENDFLYIQMELCETN-LRDES--L--
WEE_a_Smoe       -------ALREVQALSC--LGYHENVVRYFSSWFENDFLYIQMELCETN-LRDES--L--
WEE-S1_d_Smoe    ----------------------ME------------KKL---TEVMF-------------
WEE-S1_a_Smoe    -------ALREVQALSC--LGYHENVVRYFSSWSENDFLYIQMKLCEIN-LQDE---M--
GK074_Glam       --GI---LITSLKCPVC---------IPCYLCWIEDNSTYFVTDLAHC-SLDSILDYY--
                                                            .:

DDB0216398_Ddis  EEGGLGKLPEYMIWQYLCDIANGLSHVHE-KGIMHLDIKPENLLFSN--D----------
DDB0229384_Ddis  ----DQILSEELIWNFLLDVCLGIQHIHS-YNMLHLDIKPENLFISS--Q----------
SWE1_Scer        AK--KKRLEDWRIWKIIVELSLALRFIHDSCHIVHLDLKPANVMITF--E----------
CC1G_01961_Ccin  KV--FPRLDEARVWKCVVDLSNGLRFIHE-SGVIHLDLKPSNVFVTH--E----------
WEE-S1_g_Smoe    ----AWTFTEKKLTEVMFQLLNALKHLHS-HSLAHLDVKPNNIYIR---N----------
WEE-S1_c_Smoe    ------------------MLLNALKHLHS-HGLTHLDVKSDKIYIR---N----------
WEE_b_Smoe       ----SQPLDENKVWCFIRQVASGLDHIHS-HGVLHLDIKPENILICGDSE----------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ----AWTFTEKKLIEVMFQLLNTFKHLHS-HGLTHLDVKLDKIYIC---N----------
WEE-S1_b_Smoe    ----AWTFTEKKLTEAMFQLLNALKHLHS-HGLAHLDVKPDNIYIR---K----------
WEE_a_Smoe       ----AWTFTEKKLTEAMFQLLNALKHLHS-HGLAHLDVKPDNIYIR---K----------
WEE-S1_d_Smoe    ------------------QLLNTLKHLHS-HGLTHLDVKPNKIYIQ---N----------
WEE-S1_a_Smoe    ----DIHGKE--------------------------------------------------
GK074_Glam       -----HFLIEDLIWILMADISMALEYIHA-NGIAHCDLKPENILVTNRIDGYNVPPKNCG


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       DSYTIDTSMDRLTPINDPNLKRSYVAQRAAALARSKSDKAKDTYINKSQNKPFSVASSSH


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       SQQASATNTVPTTGVASVVSTPMHTSIVSTAVNQKLSEDTLYPIASENVTTSMDQLSLHT


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       TFPRAQVIHSDLRNCILSTHRQSFPLIISPCYERAADGKYFVRHKKGGFLLDKINLIKRS


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       YSDSTLVVLKHTETMLSNNYPREYIFCEYEDQFHNEVQDNSHLIIQHFELGSPMKTRYST


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       PMHRFSSTLNQTMDCQAVDADVDQGMRIPHLGMSEPVINFHFVNISERISDTEWTRSFEK


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       PQSTIENSVDSVVFSSKQDLEVFRVEEESSGGMKSNCVPNELMRHSSVLAVSAKSLEKAD


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       DVIEDLEESLTATQPSKKVEVDHLSTDATLQNTSPTSQSNKAITLLATCKHDHTCHSAVF


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       NCSEDSSTTNPKHATKLVSLQKDKSVLCAAFRKLPRNNSYRLALLAMVSRKPLYSLYFNT


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       RFLYRRRPNHWAYYFNHCKKHTYHIAKPSFLLCRSVNSVPIKPKTLMDEILSLSHYDHNS


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       QIPTVTMPAPQDQESVDQDSRGIKSAITIGLAKNFLLDSCSSSGLYIDEKSIKYANHDSS


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       KSSILSSHLEGDISPSIEADTFTKQLSSIPHQSRCAMLPAPATTGQCSHQPNLAIQYNFD


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       RYHHSGENPKVDTFRKRGHTMYNSSRHALQATTSPPSRSCSQGLTTWSVSRPTTDLSLSL


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       LLEPTSTYDSAITEYAQYRTNNFKTNSRHNELAESLNKPTLQGQKRQNAFLGSLPDDMQL


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       FNLSHSAHFQNGSFSGDIQPPFFEDYSYPNSRYAFSPAQAYKTPFTRSTGSQKKHDPCIY


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       ASSSKVHRLCRPKDMYAVLDVHPFQQMGFMDSDISCLLPPYGYQLYRANNLLSTSMCGDT


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       YGNHSPMNFLSLVPSTSHTPVNVVPVAVDTEHSSPESSSSNEGSVQHTPLLTPRQFPVLP


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       GPPDRDANCSNCSQPSIKSASFQDSMKCGDQTKQSNRPIFSPVSSDTSLSRSSVINTCNS


DDB0216398_Ddis  ------GVLKIGDF-GVCSTTTGG----------------------------------DD
DDB0229384_Ddis  ------GNIKIGDF-GMAVKLETTNNNN-NGNGGCQSNNTSMDSDCNNLSLDEDDIFFDF
SWE1_Scer        ------GNLKLGDF-GMATHLPL------------------------------EDKS-FE
CC1G_01961_Ccin  ------GRFKIGDF-GMASLWPRMAIVEADG--------------------SETTSS-FE
WEE-S1_g_Smoe    ------RVYKIGDF-GLTSQIDGT---------------------------------ISI
WEE-S1_c_Smoe    ------CVYKIGDL-GLASRIDGT---------------------------------ISI
WEE_b_Smoe       ------GTLKICDF-GLAVQKQSL---------------------------------WDW
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------HVYKIGNL-GLA------------------------------------------
WEE-S1_b_Smoe    ------GVYKIGDF-GLACRIDGA---------------------------------ISI
WEE_a_Smoe       ------GVYKIGDF-GLACRIDGA---------------------------------ISI
WEE-S1_d_Smoe    ------CVYKIGNL-GLANRIDGT---------------------------------ISI
WEE-S1_a_Smoe    --------ADRGNVSSLTNQIDGT---------------------------------ISI
GK074_Glam       QSILQNLVFTLSDF-GHAQEAP-F---------------------------------KES


DDB0216398_Ddis  SEGDQIYMAPELLNDIH--TPSADIFSLGITLYEMATNYNLPQKGQWWRNLREGKIPFPE
DDB0229384_Ddis  LEGDSRYLAYEFLLDKKQISKPSDIFSIGVTFFEMVTGNEMPTNGPLWEQLRSDKAIDFL
SWE1_Scer        NEGDREYIAPEIISDCT-YDYKADIFSLGLMIVEIAANVVLPDNGNAWHKLRSGDLSDAG
CC1G_01961_Ccin  REGDKLYLAPEVLQGR--YSKAADVFSFGMTILETATNIVVPDQGESWHRLRREDFSEVD
WEE-S1_g_Smoe    KDGNSRYLCKEPTPRDVVGQR------IPESLTEMTKSSSDG------------------
WEE-S1_c_Smoe    EDGNLRYLLMELINDDHSHLDKADMFSLGATFYKLTRYSPPPVSRRQYQA----------
WEE_b_Smoe       EEGDGAYVAPELLMDQEP-GAEADMFSFGVMVYEWATGEPLPRPNPEVEV----QIASFP
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    EDGDSRYLPMELINDDHSHLDKADMFSLGATFYELARRSPLPASGSQYQAIRQGKLALLP
WEE_a_Smoe       EDGDSRYLPMELINDDHSHLDKADMFSLGATFYELARRSPLPASGSQYQAIRQGKLALLP
WEE-S1_d_Smoe    KDGNLRYLRMELINDDHSHLDKSDMFSLGATFYELARYSPPPASRTLYQAIYQGKLALLP
WEE-S1_a_Smoe    EDGDLRYLPMELINDDHSHLDKADMFSLGVTFYELARYSLPPVSGRQYQA----------
GK074_Glam       NTGDSRYICPQFLRTGIP-DYSADVYSFGMTILEVMTNVNIPPNGESFECLRSHKKAVLD


DDB0216398_Ddis  NDD---------------------------------------------------------
DDB0229384_Ddis  EPG---------------------------------------------------------
SWE1_Scer        RLSS-T-------DIHSESLFSDITKVDTNDLFDFER-----------------DNISGN
CC1G_01961_Ccin  WEGS--------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       MLDANVFGRNLSAQLHE-------------------DDAAGSDLHRSLSFITPRI-----


DDB0216398_Ddis  ------------------------------------------------------SISQDL
DDB0229384_Ddis  ------------------------------------------------------KYSDSL
SWE1_Scer        SNNAGTSTVHNNSNINNPNMNNGNDNNNVNTAATKNRLILHKSSKIPAWVPKFLIDGESL
CC1G_01961_Ccin  ---------------------------------------------------------NEL
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------GRTAAL
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------GFSLVF
WEE_a_Smoe       ------------------------------------------------------GFSLVF
WEE-S1_d_Smoe    ------------------------------------------------------GF----
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       ------------------------------------------------------TYSKDL


DDB0216398_Ddis  KDLIILMMNPDHTKRITIQSLLKYDKLQSV------------------------------
DDB0229384_Ddis  YQVILDMMKSNITERISLDQILLNENIQLVQQKRLNQFQNIDN-----------------
SWE1_Scer        ERIVRWMIEPNYERRPTANQILQTEECLY-------------------------------
CC1G_01961_Ccin  LTLIQDMMRTDPAERIDVQEVYNHCVVARAREK---------------------------
WEE-S1_g_Smoe    -----------------------TE-----------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       TDLVRALLRLEPSRRPTAGEVLQWQ-----------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    QSLIKSLMHPAAKNRPSAAQALKNA-----------------------------------
WEE_a_Smoe       QSLIKSLMHPAAKNRPSAAQALKNA-----------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       WLAMLDLIEPDTSLRPSIRTWRKKWKSQLDRIDRTKLYQKIESDQRAVGLIMNDRLAPSA


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ----------------------IENDNNNNNNTDNNNNNNTDNI----------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       VDKMKDASSKDLLFPQHTSFTNGDSSHNPFQSTVSSCKSNADFINTLNSTYQSKVYYNKD


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       NQIHPHSINNSTATSTKMVPIKWLDSCFCQDPSKSTNAISSINRPADMLNTRPLNYGDLH


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       CSAHLDTQLNPSDLCHDTYKHAVPVPGTYTSICSCDTPCNVYAKSRSRSHCTDFQSRTEL


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       LGPDIGDDYLDFGLSYRQESMTPTTIVINKQHTNTQGSLQQDHHHVVGAMSMGPAKSVHK


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       SARSEGAETPASLERCGYLSLNWHSSLNEDSFELDHSQLKSPTSALQKAHQSALTCAGLD


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       VGALDSFSIRAESDMILLDNRMREAPSEIQVGEPFPISFQSHESSESALLSTELQLKALV


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ------------------------------------------------------------
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       DDGSCENLDVEPKDSDHLIKSAVNTTLSSKAHASTQSVALFASPRKPAEQTSATCTSESQ


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  ---------------------------------------NNDNNDDNNNNINNYNLKLIT
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  ------------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       IDSIQNDTLAVGKHVAVGQAHSSASFTSNTTDRGKANNPT--------------------


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  PYFQYQKER----KDEELKEIIEFGEIREIKEKFEHHQFAIPTPHFVRSNAGRSSSSSLF
SWE1_Scer        ------------VE-------------------------------------MTRNAGAII
CC1G_01961_Ccin  -------MEMTYAE-------------------------------------AKANGSTVF
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       ------------------------------------------------------------


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  SDEEEDDDDDDDSGRDSPIHFSLNNLNNSSSNIGISESNSNNSFSSILEENNESSSSSPL
SWE1_Scer        Q-------------------------------------------------------EDD-
CC1G_01961_Ccin  A-------------------------------------------------------ASPL
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ------------------------------------------------------------
GK074_Glam       ------------------------------------------------------------


DDB0216398_Ddis  ------------------------------------------------------------
DDB0229384_Ddis  PSLSFSRRLSTSSLVTTISPKPNFNTSGNKLFSNENNNSNNNNNNNNNNQNNNNNNGFYG
SWE1_Scer        ------------------------------------------------------------
CC1G_01961_Ccin  AS----------------------------------------------------------
WEE-S1_g_Smoe    ------------------------------------------------------------
WEE-S1_c_Smoe    ------------------------------------------------------------
WEE_b_Smoe       ------------------------------------------------------------
WEE-S1_e_Smoe    ------------------------------------------------------------
WEE-S1_f_Smoe    ------------------------------------------------------------
WEE-S1_b_Smoe    ------------------------------------------------------------
WEE_a_Smoe       ------------------------------------------------------------
WEE-S1_d_Smoe    ------------------------------------------------------------
WEE-S1_a_Smoe    ----------------------------------