Protein (view, download) , Domain (view, download)
10107_Tthe      YIFN-QVIGKGG------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      IDKN-GQLGQGG------------------------------------------------
10871_Tthe      --VE-EIIGQGG------------------------------------------------
11236_Tthe      FTIV-KKIGSGG------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      FITI-KCLARGS------------------------------------------------
15045_Tthe      YNLI-KRLGQGQ------------------------------------------------
15686_Tthe      FHMH-EKLGEGC------------------------------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------LLIKGS------------------------------------------------
18188_Tthe      FDLR-FVIGRGG------------------------------------------------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      FVFV-RPLDKGE------------------------------------------------
19573_Tthe      YKLL-ELLGTGV------------------------------------------------
19962_Tthe      YEFEPNILGHGH------------------------------------------------
20262_Tthe      YILL-EVAGRGQ------------------------------------------------
20331_Tthe      FNFH-YVIGKGG------------------------------------------------
20456_Tthe      YEIL-LTKGNGN------------------------------------------------
20643_Tthe      YASQ-QSLGSKQVIQKSQNELLEQDVNISDIPSQGAPSLIDFNILQRNGGEDHKTKSINI
20748_Tthe      FLLI-RQLGTGG------------------------------------------------
22235_Tthe      YVVG-KKLGEGA------------------------------------------------
2224_Tthe       YEVI-EYIDKGG------------------------------------------------
22340_Tthe      FKLL-RCLGEGG------------------------------------------------
22504_Tthe      YEKL-EKIGEGG------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      FTFY-RQIGEGS------------------------------------------------
24495_Tthe      FEKI-DNCGQGN------------------------------------------------
26746_Tthe      YR----------------------------------------------------------
27964_Tthe      ---D-KRLGAGG------------------------------------------------
28547_Tthe      YKIL-QKVGKGG------------------------------------------------
29162_Tthe      YEEL-EKIGEGS------------------------------------------------
3655_Tthe       FYFH-FVIGRGG------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       YKFF-ELVGTGG------------------------------------------------
4069_Tthe       FNLL-TIIGQGN------------------------------------------------
4090_Tthe       FEIV-KTLCENK------------------------------------------------
4439_Tthe       FTYQ-YVIGKGG------------------------------------------------
4723_Tthe       YELG-QILGQGS------------------------------------------------
5656_Tthe       YRLG-KKIGEGA------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       FKIV-KKIGQGN------------------------------------------------
7231_Tthe       YKVL-HVIGKGA------------------------------------------------
7312_Tthe       ELIG-EKLGEGS------------------------------------------------
7413_Tthe       FNFL-YVIGRGG------------------------------------------------
7935_Tthe       YSES-NELGSGA------------------------------------------------
2173_Tthe       FNFQ-FVIGKGG------------------------------------------------
15961_Tthe      FNFH-YVIGKGG------------------------------------------------
10000_Tthe      NISD-TVLGKGT------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ------------------------------------------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      ------------------------------------------------------------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ------------------------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      LTVGSELSQNQIGNQNVMNSSNSITNQSTSQSKQIQQQNQAQKKVKSNIFAKQFEQQHLQ
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       ------------------------------------------------------------
4439_Tthe       ------------------------------------------------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       ------------------------------------------------------------
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       ------------------------------------------------------------
15961_Tthe      ------------------------------------------------------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ------------------------------------------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      ------------------------------------------------------------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ------------------------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      YQQQQQLASQYNSQSSSRLGQKTSTTSTPQNISSGLAKSDKSLNQPLQNSTFKSMKRDVS
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       ------------------------------------------------------------
4439_Tthe       ------------------------------------------------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       ------------------------------------------------------------
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       ------------------------------------------------------------
15961_Tthe      ------------------------------------------------------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ------------------------------------------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      ------------------------------------------------------------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ------------------------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      PIKNAPYQLNNNIEDNQKIAYISSSIANPSLLVQSGQSTSSNQKAQIQKQNSFSEQFNKQ
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       ------------------------------------------------------------
4439_Tthe       ------------------------------------------------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       ------------------------------------------------------------
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       ------------------------------------------------------------
15961_Tthe      ------------------------------------------------------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ------------------------------------------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      ------------------------------------------------------------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ------------------------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      PSNLINQILPAGQTQSFIINGQYTNAPVLSNSTYNGVQLQYAPSISTSCSNLSKSQKTQS
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       ------------------------------------------------------------
4439_Tthe       ------------------------------------------------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       ------------------------------------------------------------
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       ------------------------------------------------------------
15961_Tthe      ------------------------------------------------------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ------------------------------------------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      ------------------------------------------------------------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ------------------------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      TYDQYLVKHNDSKPQSKNSIENIGGLNNNSNQQNKPNKYGIQQGKKSSYTSFSINGGNTN
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       ------------------------------------------------------------
4439_Tthe       ------------------------------------------------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       ------------------------------------------------------------
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       ------------------------------------------------------------
15961_Tthe      ------------------------------------------------------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ------------------------------------------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      ------------------------------------------------------------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ------------------------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      SQDFNNAQQLYFQEKSPSQTANNNGNTQIKANGHRRQNSYSHKSSNVATENDEQIEDYNV
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       ------------------------------------------------------------
4439_Tthe       ------------------------------------------------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       ------------------------------------------------------------
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       ------------------------------------------------------------
15961_Tthe      ------------------------------------------------------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ------------------------------------------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      ------------------------------------------------------------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ------------------------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      QSHQNLNLSVGVKNEQQRSIVNFQEEIQNQFGNLNNNISSSSQNADSIAQRMSSSSQSTV
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       ------------------------------------------------------------
4439_Tthe       ------------------------------------------------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       ------------------------------------------------------------
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       ------------------------------------------------------------
15961_Tthe      ------------------------------------------------------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ------------------------------------------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      ------------------------------------------------------------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ------------------------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      QKQFNSREQQSKKEHFGFNNKISFYNNNSSNLQKQKGQNSSYGIKESIDIYKQNANNATQ
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       ------------------------------------------------------------
4439_Tthe       ------------------------------------------------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       ------------------------------------------------------------
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       ------------------------------------------------------------
15961_Tthe      ------------------------------------------------------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ------------------------------------------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      ------------------------------------------------------------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ------------------------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      VKSKNTQSTIQSNHSMSKSLYDKNQFSNGKFEWRHKTEQNDEDNDQLAAQTYAIISGQSS
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       ------------------------------------------------------------
4439_Tthe       ------------------------------------------------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       ------------------------------------------------------------
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       ------------------------------------------------------------
15961_Tthe      ------------------------------------------------------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ------------------------------------------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      ------------------------------------------------------------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ------------------------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      TNKIVDEISKDQQNNMEQQQIQHHHQQQQQQQQQQYQQNSHQNLQINQNSLNTSKNQQQQ
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       ------------------------------------------------------------
4439_Tthe       ------------------------------------------------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       ------------------------------------------------------------
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       ------------------------------------------------------------
15961_Tthe      ------------------------------------------------------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ------------------------------------------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      ------------------------------------------------------------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ------------------------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      NKLNGFQSQHQQSFDKQFLKKNFTNYVLNQNLSNNQKQQFNQQCPEQLVNLNSNQFSSKS
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       ------------------------------------------------------------
4439_Tthe       ------------------------------------------------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       ------------------------------------------------------------
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       ------------------------------------------------------------
15961_Tthe      ------------------------------------------------------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ------------------------------------------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      ------------------------------------------------------------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ------------------------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      AMPSPGSNNIVQRMQKNIFFTKQNSINDESINTSENQMKNSLDSITIQQGKTLEKPSLFK
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       ------------------------------------------------------------
4439_Tthe       ------------------------------------------------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       ------------------------------------------------------------
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       ------------------------------------------------------------
15961_Tthe      ------------------------------------------------------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ------------------------------------------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      ------------------------------------------------------------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ------------------------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      ENFQNNFQNKTKTEESNSKVESQLSQKNSSFNSKKPLSFVLSYDSQLISNNYYYNQASPA
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       ------------------------------------------------------------
4439_Tthe       ------------------------------------------------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       ------------------------------------------------------------
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       ------------------------------------------------------------
15961_Tthe      ------------------------------------------------------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ------------------------------------------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      ------------------------------------------------------------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ------------------------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      NNTQIQMGFEQKLEMSNPVNKNISNYLTSTEEKQESKPINNQQQQQLSQINQQSKEKYSQ
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ---------