Protein (view, download) , Domain (view, download)
10107_Tthe      MRVIKYAVRL----N--------------------------Q------------------
10523_Tthe      MNNKRLDSGQH---Q---------------------------D---W--------D----
10685_Tthe      MDQSSEIKDID---F-------------------------------S--------Q----
10871_Tthe      MGNICKKTSFI---G--------------------------YN---D--------N----
11236_Tthe      MGCKESKENDA---G--------------------------RR---N-------------
11509_Tthe      MSAANSPKVGN---IWVKCQPHL------------------DE---I--------N----
13486_Tthe      MGNVCNCFGNS---S----------------------------------------N----
15045_Tthe      MSNNYQQY----------------------------------------------------
15686_Tthe      MRWKSNENRNQ---Q--------------------------KI------------D----
15767_Tthe      MKIKKQNTIRA---Q---------------------------------------------
17684_Tthe      MGLDCERSSLN---V--------------------------SELLQY--------N----
18188_Tthe      MKKVQEWIG-----Q--------------------------D------------------
19112_Tthe      MDMQISSDLRR-------------------------------L---F--------R----
19522_Tthe      MNEQNSFCEAI-------------------------------------------------
19573_Tthe      MVEVE-------------------------------------------------------
19962_Tthe      MGQTCAGAKPS---A--------------------------EH---K--------K----
20262_Tthe      MAKMV-------------------------------------------------------
20331_Tthe      MKSYKDLYK-----Q--------------------------Q------------------
20456_Tthe      MESSDNIC----------------------------------------------------
20643_Tthe      MFSRQKSGD-N---F-------------------------------I--------L-NKY
20748_Tthe      MEEQQDQVQQT---D--------------------------PF---V-GVG----R----
22235_Tthe      MSIIKNGNQTI---L--------------------------E------------------
2224_Tthe       MNVQNFGQSII------------------------------DY---R---LISQIK----
22340_Tthe      MDQYDIDLLST---Q--------------------------QD---N-------------
22504_Tthe      MTEFNDLNTS--------------------------------I-----------------
24195_Tthe      MEKYLLKINKH------------------------------N------------------
24302_Tthe      MNVIKSESDFE---S----------------------------------VY----N----
24495_Tthe      MNIDWDKLQKD---G--------------------------KL---EDP------N----
26746_Tthe      MEDRTNQLMNF---V---------------------------------------------
27964_Tthe      MSQAQKNLKLK---I---------------------------------------------
28547_Tthe      MDFGDHHEIAF---D---------------------------------------------
29162_Tthe      MENQKYQEMQN---N--------------------------EN---E--------N----
3655_Tthe       MGTTCPRPV-----E---------------------------------------------
3710_Tthe       MFALIS------------------------------------------------------
3995_Tthe       MGAKCSLAC-----D---------------------------------------------
4069_Tthe       MSGQAQQNTNG------------------------------EY---C--------T----
4090_Tthe       MGANQSCTMCV---N--------------------------PQ---E---HRGDLNQS--
4439_Tthe       MANTYFYLL-----K--------------------------T------------------
4723_Tthe       MTKKVG------------------------------------------------------
5656_Tthe       MEDKIEINRPK---S--------------------------KT---M--------S----
5692_Tthe       MFGDYDELDST---F--------------------------Q------------------
5729_Tthe       MGQCHCSEA-N---F--------------------------E------------------
7231_Tthe       MIDNQEQNDQR---L--------------------------LN---K-------------
7312_Tthe       MDKAEGSNAEMKPNL-------VQGLDILTDQNADLKDKHQEN-ERS--------N----
7413_Tthe       MGNCNFASE---------------------------------------------------
7935_Tthe       MKQISNQNR---------------------------------------------------
2173_Tthe       MIFKSLSTL-----T--------------------------S------------------
15961_Tthe      MSHIQGIRNL----K--------------------------E------------------
10000_Tthe      MGQACINGKPK---K--------------------------T----H-------------
                *

10107_Tthe      ------------------------------------------------------------
10523_Tthe      --------------------------------------L-LK------------------
10685_Tthe      --------------------------------------Q-PS------------------
10871_Tthe      --------------------------------------Y-QK------------------
11236_Tthe      --------------------------------------S-SK------------------
11509_Tthe      --------------------------------------Q-NA------------------
13486_Tthe      --------------------------------------Q---------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      --------------------------------------R--Q------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      --------------------------------------T-HS------------------
18188_Tthe      ------------------------------------------------------------
19112_Tthe      --------------------------------------Q-HQ------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      --------------------------------------N-KQ------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ------------------------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      NNTHEQSSALYTFHKPYQSQVTSDSMLGSSNMQQINKQQ-PQ------------------
20748_Tthe      --------------------------------------K-SN---------IEEY-----
22235_Tthe      ------------------------------------------------------------
2224_Tthe       --------------------------------------QIRQ------------L-----
22340_Tthe      --------------------------------------R-FN------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      --------------------------------------P-DD---------TMQS-----
24495_Tthe      --------------------------------------I-QNIINEVKQQFI--------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      --------------------------------------I-TP------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       --------------------------------------LAEE------------L-----
4090_Tthe       --------------------------------------R-RK------------VKGGIF
4439_Tthe       ------------------------------------------------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       --------------------------------------L-IE------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       --------------------------------------I-IK------------------
7312_Tthe       --------------------------------------N-QN------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       ------------------------------------------------------------
15961_Tthe      ------------------------------------------------------------
10000_Tthe      --------------------------------------R-I-------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------IGL---------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ---------------------------------C----------------T---------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ------------------I-D---------------------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------I-D---------------------------------------
18188_Tthe      ------------------------------------------------------------
19112_Tthe      ------------------L-P---------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ------------------------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      ------------------------------------------------------------
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ---------------------------------C----------------M---------
22504_Tthe      ------------------L-S---------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      --------------------T---------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       MSSSSSSSSNGSSLSSSYF-----------------------------------------
4439_Tthe       ------------------------------------------------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       --------------------RRSSTKPQLSCLQF--------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       ---------------------------------L----------------FYTVYFFRLQ
7312_Tthe       ---------------------------------LTQDQHESIQQPNSTSIK---------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       ------------------------------------------------------------
15961_Tthe      ------------------------------------------------------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ------------------------------------------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      ------------------------------------------------------------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ------------------------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      ------------------------------------------------------------
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       ------------------------------------------------------------
4439_Tthe       ------------------------------------------------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       VIEQLRESKVQYQFKELQIGCCKSFILHFQYELDIVGSVQKRVKEAQSIKQTSQLFPQYQ
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       ------------------------------------------------------------
15961_Tthe      ------------------------------------------------------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ------------------------------------------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      ------------------------------------------------------------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ------------------------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      ------------------------------------------------------------
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       ------------------------------------------------------------
4439_Tthe       ------------------------------------------------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       FKKNLQSPQKGGYSNDMYSGINPNTILSFNLQTNQAVQISLAPNDLKTPNIGKANNLVLG
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       ------------------------------------------------------------
15961_Tthe      ------------------------------------------------------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ------------------------------------------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      ------------------------------------------------------------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ------------------------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      ------------------------------------------------------------
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       ------------------------------------------------------------
4439_Tthe       ------------------------------------------------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       GNSYSNQTPVQQQQYPSINAQYSFQSAKDSQIANPALQKPGESNLKYEAIQSQQPQYNSL
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       ------------------------------------------------------------
15961_Tthe      ------------------------------------------------------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      --------------N-------------------------------D---------KM--
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      --------------------------------------------------------SS--
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      --------------D-------------------------------I---------KQ--
15767_Tthe      ------------------------------------------------------------
17684_Tthe      --------------E-------------------------------E---------D---
18188_Tthe      ------------------------------------------------------------
19112_Tthe      --------------N-------------------------------D---------KE--
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ------------------------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      ------------------------------------------------------------
20748_Tthe      --------------KQSDIFERDLAEFSRHSIQF----LEFCDQ--Q---------QE--
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      H---LFL--KNIFEQ-------------------------------Q---------RK--
22504_Tthe      --------------S-------------------------------Q---------S---
24195_Tthe      ------------------------------------------------------------
24302_Tthe      --------------EEMSF-------FNNFKYEGDDYQNNSCDEILN---------QV--
24495_Tthe      --------------E-------------------------------EKMRKCQEKNQE--
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      --------------K-------------------------------R---------KK--
29162_Tthe      ---------------------------------------------------------T--
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       --------------S-------------------------------Q---------NQ--
4439_Tthe       ------------------------------------------------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       --------------I-------------------------------N---------KR--
5692_Tthe       --------------K-------------------------------E---------KK--
5729_Tthe       -----------------------------------------------------NKNRN--
7231_Tthe       NVKNE-------------------------------------------------------
7312_Tthe       N---AQVQEKETSQH-------------------------------Q---------KKQA
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       ------------------------------------------------------------
15961_Tthe      ------------------------------------------------------------
10000_Tthe      --------------E-------------------------------D---------KD--


10107_Tthe      L-----------------------------------------------------------
10523_Tthe      L--------------------------------------------K-------------L
10685_Tthe      ------------------------------------------------------------
10871_Tthe      I--------------------------------------------T--------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      F--------------------------------------------KA-------------
13486_Tthe      ----------------------------------------------S-------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      IFNQKSSDCLL----SPFF-D-----------QVEFCKQLINQLISQQLRT---------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      -----FE------------------------CE----------IV---------------
19112_Tthe      -----------------------------------------------------------M
19522_Tthe      L-----------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      I--------------------------------------------N--------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      -----E-----------------------TKMR----------IG---------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      ------------------------------------------------------------
20748_Tthe      I--------------------------------------------SE-------------
22235_Tthe      V-----E------------------------DE----------LL---------------
2224_Tthe       M--------------------------------------------N--------------
22340_Tthe      V--------------------------------------------K--------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      I-----R-----------------------------------------------------
24302_Tthe      I--------------------------------------------LS-------------
24495_Tthe      V--------------------------------------------Q--------------
26746_Tthe      L-----------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      I--------------------------------------------K--------------
29162_Tthe      I--------------------------------------------K--------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       V--------------------------------------------N--------------
4090_Tthe       I--------------------------------------------K----TQEQQPEGKL
4439_Tthe       V-SYLFYELDVQGFSAPFKLNYEQSKSYSSKIP----------II---------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       L--------------------------------------------Q--------------
5692_Tthe       I--------------------------------------------K--------------
5729_Tthe       T--------------------------------------------G--------------
7231_Tthe       ------------------------------------------------------------
7312_Tthe       M--------------------------------------------N--------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       MLE--------------------------LSLS----------IG---------------
15961_Tthe      LYNYKYSDKLEEGI----NMN--QNN----------------------------------
10000_Tthe      V--------------------------------------------Q--------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      DLD-EKIIFS--------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ----NNISFK--------------------------------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      -----EISYE--------------------------------------------------
18188_Tthe      --------LT-------------------TIKV-----MLDVYC--Q-------------
19112_Tthe      EIATFKIFFY--------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      --------G--QG---------------------------SYYNNPS-------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      ------------------------------------------------------------
20748_Tthe      ------------------------------------------------------------
22235_Tthe      --------VS--------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      -----GLSQE--------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       YQLQSKIEFK--------------------------------------------------
4439_Tthe       --------FNF-----------------AKTKT-----LF--------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       ------------------------------------------------------------
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       -----------------------------------------FFNNFQFDESFINLFQNLN
15961_Tthe      ----------LIGGSSANGSGFNSAIGSARVKFPAFSATH--------------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      -----------CTM---------------------I------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      -----------EHK---------------------I-----IM-----------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      -----------NQN---------------------E------------------------
18188_Tthe      ----------DENQ---------------------A-----IQ-----------------
19112_Tthe      -----------PHK---------------------FL-----------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ----------DQNQ---------------------P-----LQ-----------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      ------------------------------------------------------------
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      -----------ERK---------------------S------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       -----------DSK---------------------IR-----------------------
4439_Tthe       ----------KQHK---------------------RYPKESLI-----------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------Q-----------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       ------------------------------------------------------------
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       QLKILQLKIKNQNKIKLNIQILGKAISNLINLVKLN-----FNLSYDILFDNEDALSLAK
15961_Tthe      ----------NKNK---------------------F-----MI-----------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ------------------------------------------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      ------------------------------------------------------------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ------------------------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      ------------------------------------------------------------
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       ------------------------------------------------------------
4439_Tthe       ------------------------------------------------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       ------------------------------------------------------------
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       SLEYLNNLKTLYLTLGDFNFQNGFSDIIMSGIQYLRAYNQLSNSITVFSRQLQKLKNLKC
15961_Tthe      ------------------------------------------------------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ---LS------------NDEQQTTASTLSDS-----------------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      ---TG------------K------------K-----------------------------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      ---QLQQQNVQSQASHGP------------------------------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      ------------------------------------------------------------
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ----P------------E------------K-----------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       ------------------------------------------------------------
4439_Tthe       ---QG------------K------------QDLFDIFAILLSFSNQTIRIFILIFLCLLI
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       ------------------------------------------------------------
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       LSFQIDSQNIQN------------------------------------------------
15961_Tthe      ---AN------------S------------A-----------------------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      -------------------------------------KI---------------------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      --------------------------------------G-K-------------------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      --------QNMVSMTSKQQQGSQQIM--------SSAKPVT-------------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      ------------------------------------------------------------
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ------------------------------------------------------------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       ------------------------------------------------------------
4439_Tthe       YVGWLIKSNK---------FFEERSLNVDSTNISHSSQQ-N-------------------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       ------------------------------------------------------------
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       ---------------------------------------DENDNMPRFENFAEGLLDHPK
15961_Tthe      ---------N---------VSQKKSL--------NSSKP-N-------------------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      ------------------------------------------------------------
10523_Tthe      ------------------------------------------------------------
10685_Tthe      ------------------------------------------------------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      ------------------------------------------------------------
13486_Tthe      ------------------------------------------------------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ---------------------------------------------------NS-------
15767_Tthe      ------------------------------------------------------------
17684_Tthe      ------------------------------------------------------------
18188_Tthe      --CE----------------------------------------------KN--------
19112_Tthe      ------------------------------------------------------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      ------------------------------------------------------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      --KTPLSTLIYQTAHSGSN--------------------------------NFNQQKLQQ
20456_Tthe      ------------------------------------------------------------
20643_Tthe      ------------------------------------------------------------
20748_Tthe      ------------------------------------------------------------
22235_Tthe      ---------------------------------------------------T--------
2224_Tthe       ------------------------------------------------------------
22340_Tthe      ------------------------------------------------------------
22504_Tthe      ------------------------------------------------------------
24195_Tthe      ------------------------------------------------------------
24302_Tthe      ------------------------------------------------------------
24495_Tthe      ------------------------------------------------------------
26746_Tthe      ------------------------------------------------------------
27964_Tthe      ------------------------------------------------------------
28547_Tthe      ------------------------------------------------------------
29162_Tthe      ------------------------------------------------------------
3655_Tthe       ------------------------------------------------------------
3710_Tthe       ------------------------------------------------------------
3995_Tthe       ------------------------------------------------------------
4069_Tthe       ------------------------------------------------------------
4090_Tthe       ------------------------------------------------------------
4439_Tthe       --L-------------------------------------H---------HN--------
4723_Tthe       ------------------------------------------------------------
5656_Tthe       ------------------------------------------------------------
5692_Tthe       ------------------------------------------------------------
5729_Tthe       ------------------------------------------------------------
7231_Tthe       ------------------------------------------------------------
7312_Tthe       ------------------------------------------------------------
7413_Tthe       ------------------------------------------------------------
7935_Tthe       ------------------------------------------------------------
2173_Tthe       LQTITISIESQNKLGREGLISLGKVLATLKNLEILDIYIAQSNEIQQDDSH---------
15961_Tthe      --SRNGSIFIENAASSSSNNPNSNLNLSGTNTNMINSLMVS---------NN--------
10000_Tthe      ------------------------------------------------------------


10107_Tthe      -----------------------------------------IN-----------------
10523_Tthe      -K-------------I-------------------------NK-----------------
10685_Tthe      ---------------I-------------------------TH-----------------
10871_Tthe      ------------------------------------------------------------
11236_Tthe      ------------------------------------------------------------
11509_Tthe      -E-------------I-------------------------SN-----------------
13486_Tthe      -N-------------M-------------------------QE-----------------
15045_Tthe      ------------------------------------------------------------
15686_Tthe      ET-------------F-------------------------LN-----------------
15767_Tthe      ------------------------------------------S-----------------
17684_Tthe      -N-------------L-------------------------KT-----------------
18188_Tthe      AD-------------L-------------------------SN-----------------
19112_Tthe      -A-------------K-------------------------KK-----------------
19522_Tthe      ------------------------------------------------------------
19573_Tthe      ------------------------------------------------------------
19962_Tthe      -N-------------L-------------------------QN-----------------
20262_Tthe      ------------------------------------------------------------
20331_Tthe      NQ-------------I-------------------------QN-----------------
20456_Tthe      ------------------------------------------------------------
20643_Tthe      ---------------L-------------------------NQ-----------------
20748_Tthe      -D-------------Q-------------------------LN-----------------
22235_Tthe      KK-------------V-------------------------YN-----------------
2224_Tthe       --HKQFQFILFLFSDD-------------------------NK-----------------
22340_Tthe      -L-------------V-------------------------KN-----------------
22504_Tthe      -A-------------I-------------------------ES-----------------
24195_Tthe      -----------------------------------------KN-----------------
24302_Tthe      -S-------------Q-------------------------KQ-----------------
24495_Tthe      -Q-----