Protein (view, download) , Domain (view, download)
MAST2_Hsap       MKRSRC--------------RD------------------------------------RP
MAST4_Hsap       MGEKVS--------------EA------------------------------------P-
MAST1_Hsap       MSDSLW--------------TA------------------------------------LS
MAST3_Hsap       MKSRRD--------------KL------------------------------------H-
kin-4_Cele       MRHNSL--------------FQ--------------------------------------
9978_Tthe        MCVLPTLRHLYESCGVEIYKET---------------------------------IQEMI
15619_Tthe       MIEGRL--------------GNVVICQAPYSQIANMDFTQYRQGQQNKTGQVLERSKILF
19957_Tthe       MSSQGQ--------------V-------------------------------------LV
MAST2_Spur       MSFMKQ--------------GP------------------------------------S-
MAST1_Mmus       MSDSLW--------------TA------------------------------------LS
MAST2_Mmus       MKRSRC--------------RE------------------------------------RP
MAST3_Mmus       MKSRRE--------------KL------------------------------------L-
MAST4_Mmus       MGEKVS--------------EA------------------------------------P-
DDB0185113_Ddis  MYNSQQ--------------QN------------------------------------II
DDB0216386_Ddis  METINN--------------RN--------------------------------------
DDB0220700_Ddis  MFIINK--------------N-------------------------------------LP
DDB0220701_Ddis  MKYQLS--------------IL------------------------------------G-
DDB0229452_Ddis  MYIYIN--------------NE--------------------------------------
CG6498_Dmel      MSRQEG--------------AA------------------------------------S-
AqueK009_Aque    MSGSPG--------------IP------------------------------------G-
MAST_c-2_Smoe    MKFRRG--------------AL--------------------------------------
MAST_b-2_Smoe    PRF---------------------------------------------------------
MAST_b-1_Smoe    PRF---------------------------------------------------------
MAST_c-1_Smoe    PSESVK--------------ET--------------------------------------


MAST2_Hsap       QPPPPDRREDGVQRA---------AEL---------------------------------
MAST4_Hsap       EPVPRGCS-GHGSRTPA-------SALV------------------------------AA
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       IPALTL---DLSPSSQS-------PSLL------------------------------GP
kin-4_Cele       RPLL--------------------------------------------------------
9978_Tthe        VLFYQI-YN---SSDI--------DLY---------------------------------
15619_Tthe       GMS-----NPIDLVEV--------KIY---------------------------------
19957_Tthe       GNTNNQ-SKPFEEGSL--------KFY---------------------------------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       QPPPA-RREDAAPRT---------AELP--------------------------------
MAST3_Mmus       IPALTL---DLSPSSQS-------PCLL------------------------------SP
MAST4_Mmus       EPVPRGCS-GHGARTLV-------SSAA------------------------------AV
DDB0185113_Ddis  KI-NKQ-DTDG---RL--------QLFI------------------------------V-
DDB0216386_Ddis  ---------PQ-------------------------------------------------
DDB0220700_Ddis  H-------FK--------------------------------------------------
DDB0220701_Ddis  -D-ESR-LDPT---T---------------------------------------------
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      RPADGA-TGPVASSSSSTSSNHSVSAVLGSKISTSTPQKNDEHQEQEFINQSVASEIEAM
AqueK009_Aque    Q-----------------------------------------------------------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ----------------------SQSLPPRRRAPP-------------------GRQRLE-
MAST4_Hsap       SSPGASSAESSSGSETLSEEGEPGGFSR-EHQPPPPPPLGGTLGARAPAAWAPASVLLER
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       S-----------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        ------------------------------------------------------------
15619_Tthe       ------------------------------------------------------------
19957_Tthe       ------------------------------------------------------------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       ---------------------QPQSLPPRRRAPP-------------------GRQLLE-
MAST3_Mmus       G-----------------------------------------------------------
MAST4_Mmus       SSEGASSAESSSGSETLSEEGEPSRFSC-RSQPPRPP--GGALGTRLPAAWAPARVALER
DDB0185113_Ddis  ----DAKRTLRNS--SIELES---------------------SQIYIDVTKRLID-----
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  ---------FNAFT-VYMVNV---------------------TNLMTNRQW---------
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      SISDSASAESSSGATATATA----------------------------------------
AqueK009_Aque    -------------------------FGD-QRAPPK--------------------IVYE-
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       --------------------------ERTG------------------------------
MAST4_Hsap       GVLALPPPLPGGAVPPAP-------RGSSA------------------------------
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       ------------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        -------------------------------------------------LSAFE-DNFLY
15619_Tthe       -------------------------------------------------PP-------SF
19957_Tthe       -------------------------------------------------ISSYGDYDQMF
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       --------------------------ERSG------------------------------
MAST3_Mmus       ------------------------------------------------------------
MAST4_Mmus       GVPTLPLPHPGGAVLPVP-------QVSSA------------------------------
DDB0185113_Ddis  -----------------IASLFCKQEEIQYESFAEE----LLSI---------L-NSTQF
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  ----------------------NIYRRY--SQF-HELDSEIKSAFPKIKLPKLP-KKYIF
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      ------------------------------------------------------------
AqueK009_Aque    -------------------------EEDSS------------------------------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       --------------------------------------------------PAGP--EGKE
MAST4_Hsap       --------------------------------------------------SQEE--QDEE
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       ------------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        KNVL----------------------KLLDIIAAQEKIVKKKE-NV-AT-EKKEEG----
15619_Tthe       KGSGQNDQQMQYNLQRNFVEDVNSIQIV-----QI-NELEKI--KQKSL-SVREKNSLQD
19957_Tthe       QKFF----------------------RL-----QKESLLEKK--EIQKVMQT--------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       --------------------------------------------------PLGH--DSRE
MAST3_Mmus       ------------------------------------------------------------
MAST4_Mmus       --------------------------------------------------SQEE--QDEE
DDB0185113_Ddis  KIL------------------------------GKCRE-----LVIKLLT-I--------
DDB0216386_Ddis  ------------------------------------EI----------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  KNS------------------------------TNRELVEERKLLLQKYL-KDL------
DDB0229452_Ddis  ----------------------------------IEELIECAK-KIPIL-NNNENG----
CG6498_Dmel      ------------------------------------------------------------
AqueK009_Aque    --------------------------------------------------EEEE--EEED
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       QDVVTG---VSPLLFRK-----LSNPDIFSSTGK-VKLQRQL-------------SQDDC
MAST4_Hsap       LDHILS---PPPMPFRK-----CSNPDVASGPGKSLKYKRQL-------------SEDGR
MAST1_Hsap       ------------------------NF----------------------------------
MAST3_Hsap       ------------SPCSP-----CS------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        ------------------------------------------------------------
15619_Tthe       YDDINS---KPKIKMTDSVLSETDEKAQIFFDL-SINFQYQFERIFGDLPVKNKVS----
19957_Tthe       ------------------------------------------------------------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------NF----------------------------------
MAST2_Mmus       QDMVTG---LSPLLFRK-----LSNPDIFAPTGK-VKLQRQL-------------SQDDC
MAST3_Mmus       ------------SPCSP-----CS------------------------------------
MAST4_Mmus       LDHILS---PPPMPFRK-----CSNPDVACGLGKSLKYKRQL-------------SEDGK
DDB0185113_Ddis  ------------------------------------------------------------
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  ------------------------------------------------------------
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      ---TMS---GSPVPKRH-----LSTANLSRIRPQSSYSARVL-------------IFDDS
AqueK009_Aque    YDDGLNKTLPPNFKFRH-----KSQPVMTSSMLH-PTHQSRS-------------SPMHT
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       KLWRG--------------NLASSLSGKQLLP--------------L-------------
MAST4_Hsap       QLRRG--------------SLGGALTGRYLLP--------------N-------------
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       ------------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        --------------------------------TSHQST-----K------------TKQL
15619_Tthe       -DIKS--------------RIGQATTLIKIIP--------------ISVLKMATPKST--
19957_Tthe       -------------------------------QIAHSYV-----NHAFLTLKD-IPFI---
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       KLRRG--------------SLASSLSGKQLLP--------------L-------------
MAST3_Mmus       ------------------------------------------------------------
MAST4_Mmus       QLRRG--------------SLGGALTGRYLLP--------------N-------------
DDB0185113_Ddis  ------------------------------------------------------------
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  --------------------------------VKHEQIEDSDCLINWLVPQN-EPAFTS-
DDB0229452_Ddis  --------------------------------NDHN---------------------KSI
CG6498_Dmel      DQEAAAAAAALAAASSSCNSSVKSCSGLELLP--------------T-------------
AqueK009_Aque    ------------------------------------------------------------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ------------------------------------------------------------
MAST4_Hsap       ------------------------------------------------------------
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       ------------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        LVAPSKKKVVKILITDEPSYVKLIGKEIKLFKYSLFPMVHYLQVAR--------------
15619_Tthe       -----SLNYA-----------------------------------KLRNQKRNNSNVDID
19957_Tthe       ------------------------------------------------------------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       ------------------------------------------------------------
MAST3_Mmus       ------------------------------------------------------------
MAST4_Mmus       ------------------------------------------------------------
DDB0185113_Ddis  ------------------------------------------------------------
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  -----------LNNPDKSGYLIKEGHVIRSWKKRYFVL----KDGL--------------
DDB0229452_Ddis  SKLIT-------------------------------------------------------
CG6498_Dmel      ------------------------------------------------------------
AqueK009_Aque    ------------------------------------------------------------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ------------------------------------------------------------
MAST4_Hsap       ------------------------------------------------------------
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       ------------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        ------VNYESHTQEQQEIV----------------------------------------
15619_Tthe       KDLGNLY-------RNQDTQQASSQIRVQQVDNTNFLQEKKTNQINYNQNGQIVNSQQEP
19957_Tthe       ----------------------------QSIQNT--------------------------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       ------------------------------------------------------------
MAST3_Mmus       ------------------------------------------------------------
MAST4_Mmus       ------------------------------------------------------------
DDB0185113_Ddis  ------------------------------------------------------------
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  ---I---YYFKHQSDQ--EPTGMIPVIGSQI-----------------------------
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      ------------------------------------------------------------
AqueK009_Aque    ------------------------------------------------------------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ------------------------------------------------------------
MAST4_Hsap       ------------------------------------------------------------
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       ------------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        --------------------------------K-----NHAQLIR-------------LF
15619_Tthe       QQNQIGNNKGIHNQASAGQGNQNQQQPVQSLKQ-----QQQQSFQ-------------LN
19957_Tthe       ------------------------------------------------------------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       ------------------------------------------------------------
MAST3_Mmus       ------------------------------------------------------------
MAST4_Mmus       ------------------------------------------------------------
DDB0185113_Ddis  ----------------------------------------------IAKYARVNQLLGIE
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  --------------------------------KRIGETERKFSFQIIPKNETFFPTFSIQ
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      ------------------------------------------------------------
AqueK009_Aque    ------------------------------------------------------------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       -----------------------------------S------------------------
MAST4_Hsap       ------------------------------------------------------------
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       ------------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        GFNIQHLENQTTAA----------------------------------------DQKVHK
15619_Tthe       QKNIQEFQYKQNSTQQYDNQNQNIQLKPELNVIQNDSKQDNQNSFQAQNQSQQLQQQIQN
19957_Tthe       --------------------------------------------RIHIPASITL------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       -----------------------------------S------------------------
MAST3_Mmus       ------------------------------------------------------------
MAST4_Mmus       ------------------------------------------------------------
DDB0185113_Ddis  S-----------------------------------------------------------
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  ARD---------------------------------------------------------
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      -----------------------------------S------------------------
AqueK009_Aque    ------------------------------------------------------------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ------------------------------------------------------------
MAST4_Hsap       ------------------------------------------------------------
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       ------------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        LEKWKIKKWCKHVLNHLSNQLGLLDKEKLTLKCRLCDSKIDVSEAK--------------
15619_Tthe       QEKKSQPSDAAYQSNQDYIDQMIKQKKHVEDPTKLKQKNVIGKTPIPPFMKNFHQMQQMQ
19957_Tthe       -----------------------AK-----------------------------------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       ------------------------------------------------------------
MAST3_Mmus       ------------------------------------------------------------
MAST4_Mmus       ------------------------------------------------------------
DDB0185113_Ddis  ------------------------------------------------------------
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  --EQDCNDW---------------------------------------------------
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      ------------------------------------------------------------
AqueK009_Aque    ------------------------------------------------------------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ------------------------------------------------------------
MAST4_Hsap       ------------------------------------------------------------
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       ------------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        PHSEICLKNSQTKKKILAMDQELVHLINESVKLRNQYRKDMNLMIVKQARQIR-------
15619_Tthe       QQQELIMKQQKTKQQLK-------------------------------------------
19957_Tthe       ----------GLSATSS-------------------------------------------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       ------------------------------------------------------------
MAST3_Mmus       ------------------------------------------------------------
MAST4_Mmus       ------------------------------------------------------------
DDB0185113_Ddis  ------------------------------------------------------------
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  ---------------------------IKAIELSQQHFQD---------QEQYRKQEEEE
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      ------------------------------------------------------------
AqueK009_Aque    ------------------------------------------------------------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       -------------SS---------------------------------------------
MAST4_Hsap       ------------------------------------------------------------
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       ------------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        ----------------NAQKEDGLDKFGE------------------------DQSPTN-
15619_Tthe       ------------------------------------------------------SSQSQQ
19957_Tthe       ------------------------------------------------------DKPSTQ
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       -------------SS---------------------------------------------
MAST3_Mmus       ------------------------------------------------------------
MAST4_Mmus       ------------------------------------------------------------
DDB0185113_Ddis  ---------KDRSPSSSINKNNGFDQLYDFELNRIDENNNNNNNNNNNNNNNNNKNKTI-
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ---------NDFS-----------------------------------------------
DDB0220701_Ddis  RQKKNNGARIKKSGSF--------------------------------------EFSTL-
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      -------------PA------------------KL--SIGNDSTNGSSMMRNL-------
AqueK009_Aque    -------------PP------------------QD--GEGSPNNRSGTGLRR--------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ------------------------------------------------------------
MAST4_Hsap       ------------------------------------------------------------
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       ------------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        ---------------------------------------------NSQH-----------
15619_Tthe       YQQQ--------------------------NSNDT--------VRLNQNSSVNSQAKNVA
19957_Tthe       YMVLNGVNNISYDANHYQKGYLFDTIKLLVTLSFQISSYLESLCYNQQ----EELVNSF-
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       ------------------------------------------------------------
MAST3_Mmus       ------------------------------------------------------------
MAST4_Mmus       ------------------------------------------------------------
DDB0185113_Ddis  ---------------------------------------------SPTH-----------
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  ---------------------------------------------TSAS-----------
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      -------------------------------------------------NLT----KSSS
AqueK009_Aque    ------------------------------------------------------------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ----------VHSS-------------VGQVTWQSSGEASNLVRMRNQSLGQSAPSLTA-
MAST4_Hsap       -------------P-------------VAGQAWPASAETSNLVRMRSQALGQSAPSLTA-
MAST1_Hsap       ----------------------------------------------------SMPSFPG-
MAST3_Hsap       ------------------------------------------------------P-----
kin-4_Cele       ------------------------------------------AKFRYRS-----------
9978_Tthe        ------------------------------------------------------------
15619_Tthe       EKQQEDESIQIENN-------------SQQVNEQQTNQDDKLT--QRKTLGNSQPKLFDQ
19957_Tthe       CKTLNDFQTHIHCK-------------VKQIQ-------ENIDLIRNKVIEQICRICDA-
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ----------------------------------------------------SMPSFPG-
MAST2_Mmus       ----------VHSS-------------VGQVTWQSTGEASNLVRMRNQSLGQSAPSLTA-
MAST3_Mmus       ------------------------------------------------------P-----
MAST4_Mmus       -------------P-------------VAGQAWPASAETSNLVRMRSQALGQSAPSLTA-
DDB0185113_Ddis  ------------------------------------------------------------
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  ------------------------------------------------------------
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      GG-LSGSSSSLHSRGYTALLRKISYQQHTNSLRAVSGETSNLLRMRHSSLGKSAPCLTG-
AqueK009_Aque    ------------------------------SKPVDSSQKPNWSRYRERQLGKSDPSLSP-
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ------------------------------------------------------------
MAST4_Hsap       ------------------------------------------------------------
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       ------------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        ---------TLAKPTTSS---RRLRPMLSMCSSDQVYKE--DENTNNEAISNHSLSVVDE
15619_Tthe       FFRNNSYQGTLSSNSQPS---HQIQVAQ----------TQRNNNTHQE------------
19957_Tthe       ------------------------------------------------------------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       ------------------------------------------------------------
MAST3_Mmus       ------------------------------------------------------------
MAST4_Mmus       ------------------------------------------------------------
DDB0185113_Ddis  ---------QTIQATIPS---PKLQPFLDHDDK---------------------------
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  ---------APTSPVQSSSSTSNMLPSSYQ------------------------------
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      ------------------------------------------------------------
AqueK009_Aque    ------------------------------------------------------------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ------------------------------------------------------------
MAST4_Hsap       ------------------------------------------------------------
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       ------------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        DSLSNSSQSRIGHNISPSIRIERKSGRRIGTQIHSEKIPSISNIPKKIVELDEQKLEQFK
15619_Tthe       ------------------------------------------------------------
19957_Tthe       ------------------------------------------------------------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       ------------------------------------------------------------
MAST3_Mmus       ------------------------------------------------------------
MAST4_Mmus       ------------------------------------------------------------
DDB0185113_Ddis  ------------------------------------------------------------
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  ------------------------------------------------------------
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      ------------------------------------------------------------
AqueK009_Aque    ------------------------------------------------------------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ------------------------------------------------------------
MAST4_Hsap       ------------------------------------------------------------
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       ------------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        KNGDVLKELITYGEKVINANEQTLDIRNEIQLK-Q-MIESLKGSFTSEDDQIMS----QL
15619_Tthe       ------------------------------------------------------------
19957_Tthe       ------------------------------------------------------------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       ------------------------------------------------------------
MAST3_Mmus       ------------------------------------------------------------
MAST4_Mmus       ------------------------------------------------------------
DDB0185113_Ddis  ------------------------------DDK-E-IIDIVSNKD---KDQLNGVDDVDL
DDB0216386_Ddis  ----------------------------------------------------N-------
DDB0220700_Ddis  ----------------------------------D-YYSKL-------------------
DDB0220701_Ddis  --------------------------------FSSDG-----------------------
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      ------------------------------------------------------------
AqueK009_Aque    ------------------------------------------------------------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ---------------------------------GL--KELSLPR----------------
MAST4_Hsap       ---------------------------------SL--KELSLPR----------------
MAST1_Hsap       ---------------------------------G------SMFR----------------
MAST3_Hsap       ----------------------------------------SLGL----------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        INKFELHLQERIEITKKAQKYDQNLRDTSSSNTNV--NS---------------------
15619_Tthe       ---------------------------------KI--QNISVLS----------------
19957_Tthe       ---------------------------------KI--NINNITE----------------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ---------------------------------G------SMFR----------------
MAST2_Mmus       ---------------------------------GL--KELSLPR----------------
MAST3_Mmus       ----------------------------------------SLGL----------------
MAST4_Mmus       ---------------------------------SL--KELSLPR----------------
DDB0185113_Ddis  SNTSGISCKEIFEKNPINFQKSHYRCL-SYSPKLL--------E----------------
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  -----------------------SNNNSVC-SSIG--A-----L----------------
DDB0229452_Ddis  ---------------------------------IF--KS---------------------
CG6498_Dmel      ---------------------------------NYFRHELTAPLPVQPPGFGASPLGGHN
AqueK009_Aque    ---------------------------------ET--ATGLFSP----------------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ---RG-----------------------------------SFC-----------------
MAST4_Hsap       ---RGSL-----IDSQKWN------------------CLVKRC-----------------
MAST1_Hsap       ---RT-----------------------------------KSC-----------------
MAST3_Hsap       ---HP-----------------------------------WSC-----------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        -----------------------------------------SA-----------------
15619_Tthe       ---NQ-----------------------------------SDL-----------------
19957_Tthe       ---HS-----------------------------------KTC-----------------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ---RT-----------------------------------KSC-----------------
MAST2_Mmus       ---RG-----------------------------------SFC-----------------
MAST3_Mmus       ---QP-----------------------------------WSC-----------------
MAST4_Mmus       ---RGSL-----VDSQKWN------------------CLVKRC-----------------
DDB0185113_Ddis  ---QQ-----------------------------------LQQ-----------------
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  ---GP-----------------------------------NNSNNNNNNNNNSYYYSHSS
DDB0229452_Ddis  -----------------------------------------KQ-----------------
CG6498_Dmel      ISRSGSCAGIGLAKHHHHHHLHGVVMRGSAGGGAGSGGGSSSG-----------------
AqueK009_Aque    ---EESF-----EDHDHES------------------ELADHL-----------------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ---------------------------R-TSNRK-SL-IVTSS--T-----------SPT
MAST4_Hsap       ---------------------------R-TSNRK-SL-IGN-G--Q-----------SPA
MAST1_Hsap       ---------------------------R-TSNRK-SL-ILT-S--T-----------SPT
MAST3_Hsap       ---------------------------R-SGNRK-SL-VVG-T--P-----------SPT
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        ---------------------------Q-AQNKK-NM-LTG-I--SGSVKVKNFKFGTTS
15619_Tthe       ---------------------------K-NSNNT-SQ-VLT-Q--P-----------AQS
19957_Tthe       ---------------------------LEKANQK-KE-ILE-LDIK--------------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ---------------------------R-TSNRK-SL-ILT-S--T-----------SPT
MAST2_Mmus       ---------------------------R-TSNRK-SL-IVTSS--T-----------SPT
MAST3_Mmus       ---------------------------R-SGNRK-SL-VVG-T--P-----------SPT
MAST4_Mmus       ---------------------------R-TSNRK-SL-IGN-G--Q-----------SPA
DDB0185113_Ddis  ---------------------------K-LVNQQIKL-KNG-K--P-----------SP-
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  NNHNHYNHHNNNHNNSHHHHHHHNGLNR-GSSQV-SL-SVN-T--T-----------SS-
DDB0229452_Ddis  ---------------------------R--------------------------------
CG6498_Dmel      ---------------------------V-AHHRL-SL-VTN-S--A-----------AVA
AqueK009_Aque    ---------------------------S-----A-HLRLP-PS--R-----------TQS
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ------------------------------------------------------------
MAST4_Hsap       ------------------------------------------------------------
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       ------------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        L-----------------------------------------------------------
15619_Tthe       QQIFHSNHFNTSPSHSNEQQLINNSSSNQHQNHHLSSINRDNPITSKRQSHTQIHQHQSQ
19957_Tthe       ----------LSKIV--------------------------------EKAIEMRHSNKQN
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       ------------------------------------------------------------
MAST3_Mmus       ------------------------------------------------------------
MAST4_Mmus       ------------------------------------------------------------
DDB0185113_Ddis  I-----------------------------------------------------------
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  N-----------------------------------------------------------
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      A-----------------------------------------------------------
AqueK009_Aque    ------------------------------------------------------------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ----------------------L--PRPHSPLHG-HTGN---------------------
MAST4_Hsap       ----------------------L--PRPHSPLSA-HAGN---------------------
MAST1_Hsap       ----------------------L--PRPHSPLPG-HLGS---------------------
MAST3_Hsap       ----------------------L--SRPLSPLSVPTAGS---------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        -------------------------NKPKSGFNTPTAQQATANS----------------
15619_Tthe       QSQTQNHQKKESSLFNSQSSTIL--NNSLGNIS-PTAQFNNLDSSQFNISNISNIQNLSH
19957_Tthe       ---------------------------------------IQI------------------
MAST2_Spur       ------------------------------------AER---------------------
MAST1_Mmus       ----------------------L--PRPHSPLPG-HLGS---------------------
MAST2_Mmus       ----------------------L--PRPHSPLHG-HTGN---------------------
MAST3_Mmus       ----------------------L--SRPLSPLSVPTAGN---------------------
MAST4_Mmus       ----------------------L--PRPHSPLSA-HAGN---------------------
DDB0185113_Ddis  -------------------------KRPSPPLPPPQQQQKEQQK----------------
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  ----------------------SSGSSSSTSLSRRH------------------------
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      --------------------AGG--SRTHSP-----YSA---------------------
AqueK009_Aque    ----------------------L--NQPKSPRSPRISSP---------------------
MAST_c-2_Smoe    -------------------------------------GR---------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ------------------------------------------------------------
MAST4_Hsap       ------------------------------------------------------------
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       ------------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        ---------------------------------E-SDAQQPQQD-----SQ---------
15619_Tthe       NVSSINNQSNIMINYNSNNVMNNSNMNSTMSFQKQFEEQLPYNE-----NNQGKEEAQNS
19957_Tthe       ------------------------------------------------------------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       ------------------------------------------------------------
MAST3_Mmus       ------------------------------------------------------------
MAST4_Mmus       ------------------------------------------------------------
DDB0185113_Ddis  ---------------------------------E-QKEQQKEQQKEQQKE----------
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  ------------------------------------------------------------
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      ------------------------------------------------------------
AqueK009_Aque    ------------------------------------------------------------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ------------------------------------------------------------
MAST4_Hsap       ------------------------------------------------------------
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       ------------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        ------------------------------------------------------------
15619_Tthe       DFLNSLNIYIDYFNSALQEGEKSVKISQQSNTNLELFKENQRLKQQLEQLEEKLKETETS
19957_Tthe       ------------------------------------------------------------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       ------------------------------------------------------------
MAST3_Mmus       ------------------------------------------------------------
MAST4_Mmus       ------------------------------------------------------------
DDB0185113_Ddis  ------------------------------------------------------------
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  ------------------------------------------------------------
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      ------------------------------------------------------------
AqueK009_Aque    ------------------------------------------------------------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ------------------------------------------------------------
MAST4_Hsap       ------------------------------------------------------------
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       ------------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        --------------------------SQ-SQEAAA-------------------------
15619_Tthe       RKILINDLSKLKNKDSEYKKKIQQLAKENSETKTLLLSTNYKLHHTKEQYAKEKIEHENT
19957_Tthe       ------------------------------------------------------------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       ------------------------------------------------------------
MAST3_Mmus       ------------------------------------------------------------
MAST4_Mmus       ------------------------------------------------------------
DDB0185113_Ddis  ------------------------------------------------------------
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  ------------------------------------------------------------
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      ------------------------------------------------------------
AqueK009_Aque    ------------------------------------------------------------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ------------------------------------------------------------
MAST4_Hsap       ------------------------------------------------------------
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       ------------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        ------------------------------------------------------------
15619_Tthe       KFTLKKALLARSNNLENSNLLNKADNNITQQKNQTQKKSFLQQYNIQENRSLQNNQKFGI
19957_Tthe       ------------------------------------------------------------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       ------------------------------------------------------------
MAST3_Mmus       ------------------------------------------------------------
MAST4_Mmus       ------------------------------------------------------------
DDB0185113_Ddis  ------------------------------------------------------------
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  ------------------------------------------------------------
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      ------------------------------------------------------------
AqueK009_Aque    ------------------------------------------------------------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ------------------------------------------------------------
MAST4_Hsap       ------------------------------------------------------------
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       ------------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        -------------------VASPKPEEKKEEPKKKMMVFGSNANKKLQEKQAAKKTQSGI
15619_Tthe       NNQAISQQYQRPYQNSYKILND--PHNNY-------------------------------
19957_Tthe       -------------------------EMRR-------------------------------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       ------------------------------------------------------------
MAST3_Mmus       ------------------------------------------------------------
MAST4_Mmus       ------------------------------------------------------------
DDB0185113_Ddis  --------------------QQKEQEQKQQEP---------------------QKYVKFE
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  ------------------------------------------------------------
DDB0229452_Ddis  ------------------------------------------------------------
CG6498_Dmel      ------------------------------------------------------------
AqueK009_Aque    ------------------------------------------------------------
MAST_c-2_Smoe    ------------------------------------------------------------
MAST_b-2_Smoe    ------------------------------------------------------------
MAST_b-1_Smoe    ------------------------------------------------------------
MAST_c-1_Smoe    ------------------------------------------------------------


MAST2_Hsap       ------------------------------------------------------------
MAST4_Hsap       ------------------------------------------------------------
MAST1_Hsap       ------------------------------------------------------------
MAST3_Hsap       ------------------------------------------------------------
kin-4_Cele       ------------------------------------------------------------
9978_Tthe        ---------IEPS------ELQQQATSSMSNSLNSAQGTSA-------------------
15619_Tthe       ---------------------------------------IN-------------------
19957_Tthe       ---------------------------------------KN-------------------
MAST2_Spur       ------------------------------------------------------------
MAST1_Mmus       ------------------------------------------------------------
MAST2_Mmus       ------------------------------------------------------------
MAST3_Mmus       ------------------------------------------------------------
MAST4_Mmus       ------------------------------------------------------------
DDB0185113_Ddis  IQKSPPSNLLPPLPISSSNISNEISKQQQQQQQQQQQQQQQQQQQQQQQQQQQ-------
DDB0216386_Ddis  ------------------------------------------------------------
DDB0220700_Ddis  ------------------------------------------------------------
DDB0220701_Ddis  ---------------------------------------PPQKS</