Protein (view, download) , Domain (view, download)
SIK_Hsap         MVIMSEFSAD--------------------------------------------------
QSK_Hsap         MAAAAASGAGGA--AGAGTGGAG-------------------------------------
QIK_Hsap         MVMAD-------------------------------------------------------
CG15072_Dmel     MATTPTA--GPAA-----------------------------------------------
kin-29_Cele      MAAP--------------------------------------------------------
QIK_Mmus         MVMAD-------------------------------------------------------
QSK_Mmus         MAAAAASGAGGV--AVAGAGGAG-------------------------------------
SIK_Mmus         MVIMSEFSAV--------------------------------------------------
DDB0231454_Ddis  MNTHNNNY------QQRSMDSAIVTINDKGYIQSVDRKTCELFGYTIEELQLQKVNILVP
QSK_Spur         ------------------------------------------------------------
SIK_Spur         MVVMEEKADT--------------------------------------------------
CG4290_Dmel      MSTCEAAAAGENGSQAKSEESQP-------------------------------------
AqueK068_Aque    LALKLQKETRRV------------------------------------------------
AqueK069_Aque    MDL---------------------------------------------------------


SIK_Hsap         ------------------------------------------------------------
QSK_Hsap         -PA---------------------------------------------------------
QIK_Hsap         ------------------------------------------------------------
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      ------------------------------------------------------------
QIK_Mmus         ------------------------------------------------------------
QSK_Mmus         -PA---------------------------------------------------------
SIK_Mmus         ------------------------------------------------------------
DDB0231454_Ddis  SPYKEQHDTYMQSYFETGVRKIIDKSRVVEGLHKDGSVFPITLSVTEVRIWNKRMFIGSI
QSK_Spur         ------------------------------------------------------------
SIK_Spur         ------------------------------------------------------------
CG4290_Dmel      -PE---------------------------------------------------------
AqueK068_Aque    ------------------------------------------------------------
AqueK069_Aque    ------------------------------------------------------------


SIK_Hsap         ------------------------------------------------------------
QSK_Hsap         -----------------------------------------GRLLPPPA---PGSPAAPA
QIK_Hsap         ------------------------------------------------------------
CG15072_Dmel     ---------------------------------------------------------APP
kin-29_Cele      ------------------------------------------------------------
QIK_Mmus         ------------------------------------------------------------
QSK_Mmus         -----------------------------------------GRLLPPPA---AGPPAAPA
SIK_Mmus         ------------------------------------------------------------
DDB0231454_Ddis  ESIIDKRLIIYTDVHGIITYCNRNVEELIGYTPAELFGKNVS------------------
QSK_Spur         ------------------------------------------------------------
SIK_Spur         ------------------------------------------------------------
CG4290_Dmel      -----------------------------------------DQKKKQPQHERNEKQLDKP
AqueK068_Aque    -----------------------------------------------------------I
AqueK069_Aque    ------------------------------------------------------------


SIK_Hsap         ------------------------------------------------------------
QSK_Hsap         -AVSPAAGQ---------------------------------------------------
QIK_Hsap         ------------------------------------------------------------
CG15072_Dmel     TSSTPQNYK---------------------------------------------------
kin-29_Cele      ------------------------------------------------------------
QIK_Mmus         ------------------------------------------------------------
QSK_Mmus         -AVPPAAVP---------------------------------------------------
SIK_Mmus         ------------------------------------------------------------
DDB0231454_Ddis  -----------------ALMPSP------------HAKSHSEYIEKNYHGGGLWKMLNRV
QSK_Spur         ------------------------------------------------------------
SIK_Spur         ------------------------------------------------------------
CG4290_Dmel      PENLPQNGKTEAKGAEGACSHPPLDALRSSVLLDAGA-----------------------
AqueK068_Aque    -TTMDHRLS---------------------------------------------------
AqueK069_Aque    ------------------------------------------------------------


SIK_Hsap         ------------------------------------------------------------
QSK_Hsap         ------------------------------------------------------------
QIK_Hsap         ------------------------------------------------------------
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      ------------------------------------------------------------
QIK_Mmus         ------------------------------------------------------------
QSK_Mmus         ------------------------------------------------------------
SIK_Mmus         ------------------------------------------------------------
DDB0231454_Ddis  RNLPIKHKSGVVFLVSILVTKISTDGIDMFKAIIQTPPKEAVFTINGDGIIKACNFNFTE
QSK_Spur         ------------------------------------------------------------
SIK_Spur         ------------------------------------------------------------
CG4290_Dmel      ------------------------------------------------------------
AqueK068_Aque    ------------------------------------------------------------
AqueK069_Aque    ------------------------------------------------------------


SIK_Hsap         ------------------------------------------------------------
QSK_Hsap         ------------------------------------------------------------
QIK_Hsap         ------------------------------------------------------------
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      ------------------------------------------------------------
QIK_Mmus         ------------------------------------------------------------
QSK_Mmus         ------------------------------------------------------------
SIK_Mmus         ------------------------------------------------------------
DDB0231454_Ddis  PMFGYTQKDLLGNTIGLLIPEMSKIIDNTSLNLTDSHDPQLQQQQQTTTTTTTTTTTTS-
QSK_Spur         ------------------------------------------------------------
SIK_Spur         ------------------------------------------------------------
CG4290_Dmel      ------------------------------------ASP----------------SIDAI
AqueK068_Aque    ------------------------------------------------------------
AqueK069_Aque    ------------------------------------------------------------


SIK_Hsap         ------------------------PAG---------------------------------
QSK_Hsap         ----------------------PRPPA---------------------------------
QIK_Hsap         --------------------------G---------------------------------
CG15072_Dmel     -----------------------VPST---------------------------------
kin-29_Cele      ------------------------------------------------------------
QIK_Mmus         --------------------------G---------------------------------
QSK_Mmus         ----------------------ARPTA---------------------------------
SIK_Mmus         ------------------------PSG---------------------------------
DDB0231454_Ddis  --------------TTSTTTSTPTPASIAVSGNNISSPPIDSPLTTPSTPTTFNHSRGVE
QSK_Spur         ------------------------------------------------------------
SIK_Spur         ------------------------PT----------------------------------
CG4290_Dmel      VACKDALLAQKLFASGGGSTPGPSPTSSAVGAGGIS--------------GK--------
AqueK068_Aque    ----------------------IMSTA---------------------------------
AqueK069_Aque    ------------------------------------------------------------


SIK_Hsap         ------------------------------------------------------------
QSK_Hsap         ------------------------------------------------------------
QIK_Hsap         ------------------------------------------------------------
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      ------------------------------------------------------------
QIK_Mmus         ------------------------------------------------------------
QSK_Mmus         ------------------------------------------------------------
SIK_Mmus         ------------------------------------------------------------
DDB0231454_Ddis  SWLGRTRKVDVWHRDGSRFPVNLEIIKLQGENSMFSLQIKKVENPRVYGKDKDKNGGGGG
QSK_Spur         ------------------------------------------------------------
SIK_Spur         ------------------------------------------------------------
CG4290_Dmel      ------------------------------------------------------------
AqueK068_Aque    ------------------------------------------------------------
AqueK069_Aque    ------------------------------------------------------------


SIK_Hsap         ------------------------------------------------------------
QSK_Hsap         ------------------------------------------------------------
QIK_Hsap         ------------------------------------------------------------
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      ------------------------------------------------------------
QIK_Mmus         ------------------------------------------------------------
QSK_Mmus         ------------------------------------------------------------
SIK_Mmus         ------------------------------------------------------------
DDB0231454_Ddis  TTENKDGKQLDTIKESKEHRHSKEKKKRKKDRDHNNNNNNNNNNNNNNNEQTSDSSDSSD
QSK_Spur         ------------------------------------------------------------
SIK_Spur         ------------------------------------------------------------
CG4290_Dmel      ------------------------------------------------------------
AqueK068_Aque    ------------------------------------------------------------
AqueK069_Aque    ------------------------------------------------------------


SIK_Hsap         -------------------------------------------------------Q-GQG
QSK_Hsap         -------------------------------------------------------P-ASR
QIK_Hsap         -------------------------------------------------------P-RHL
CG15072_Dmel     -------------------------------------------------------S-KIS
kin-29_Cele      ----------------------------------------------------------RR
QIK_Mmus         -------------------------------------------------------P-RHL
QSK_Mmus         -------------------------------------------------------P-ASR
SIK_Mmus         -------------------------------------------------------T-GQG
DDB0231454_Ddis  SDSESRSKKKRSSKKKSRRDDSSSDSSDSETESSSSPHKKNRSSNSSSNSSHSNAPHESS
QSK_Spur         ------------------------------------------------------------
SIK_Spur         -------------------------------------------------------Q-AKP
CG4290_Dmel      -------------------------------------------------------D-LLK
AqueK068_Aque    -------------------------------------------------------I-PES
AqueK069_Aque    ------------------------------------------------------------


SIK_Hsap         QQKPLRVGFYDIERTLGKGNFAVVKLARHRVTKTQVAIKIIDK-TRLDSSNLEKIYREVQ
QSK_Hsap         GPMPARIGYYEIDRTIGKGNFAVVKRATHLVTKAKVAIKIIDK-TQLDEENLKKIFREVQ
QIK_Hsap         QRGPVRVGFYDIEGTLGKGNFAVVKLGRHRITKTEVAIKIIDK-SQLDAVNLEKIYREVQ
CG15072_Dmel     VDKLLRVGYYELEKTIGKGNFAVVKLATNIVTKTKVAIKIIDK-TCLNEEYLNKTFREIA
kin-29_Cele      RMGLEKIGLYDVGRAIGKGNFATVRIARHKIAKTKVAIKSIDV-SALDRENLIKLEREVK
QIK_Mmus         QRGPVRVGFYDIEGTLGKGNFAVVKLGRHRITKTEVAIKIIDK-SQLDAVNLEKIYREVQ
QSK_Mmus         GSMAARIGYYEIDRTIGKGNFAVVKRATHLVTKAKVAIKIIDK-SQLDEENLKKIFREVQ
SIK_Mmus         QQKPLRVGFYDVERTLGKGNFAVVKLARHRVTKTQVAIKIIDK-TRLDSSNLEKIYREVQ
DDB0231454_Ddis  YYQPEMIGEYTLGKTLGRGNYGVVKLGTHINTKEEIAIKILYK-EQMTESEFTRCKREIE
QSK_Spur         ----------------------------------QVAIKIIDK-TQLEGDNIQKIVREVK
SIK_Spur         RRGHIRVGFYDIDRTIGKGNFAVVKLAKHRITKSQVAIKIIDK-SRLDESNLKKVYREVQ
CG4290_Dmel      LKEPMRVGFYDIERTIGKGNFAVVKLARHRITKNEVAIKIIDK-SQLDQTNLQKVYREVE
AqueK068_Aque    IANQSRIGYYELEKVIGRGNFAIVKLATHTVSKMKVAIKIIDK-SRLDKENLKKVQREVE
AqueK069_Aque    -EGCLVGGVYEVKRRLQSGYFGVTWLAENKTTNRDVCLKTFFNESQS-------QRKELV
                                                   .:.:* :               :*:

SIK_Hsap         LMKLLN-----HPHIIKLYQVMETK------------DMLYIVTEFAKNGEMFDYLTSNG
QSK_Hsap         IMKMLC-----HPHIIRLYQVMETE------------RMIYLVTEYASGGEIFDHLVAHG
QIK_Hsap         IMKMLD-----HPHIIKLYQVMETK------------SMLYLVTEYAKNGEIFDYLANHG
CG15072_Dmel     ILKSLR-----HPHITRLYEVMESQ------------SMIYLVTEYAPNGEIFDHLVANG
kin-29_Cele      IVKVID-----HPHIVKSYEIMRVD------------NMLYIVSEYCSSGELYETLIEK-
QIK_Mmus         IMKMLD-----HPHIIKLYQVMETK------------SMLYLVTEYAKNGEIFDYLANHG
QSK_Mmus         IMKMLC-----HPHIIRLYQVMETE------------RMIYLVTEYASGGEIFDHLVAHG
SIK_Mmus         LMKLLN-----HPNIIKLYQVMETK------------DMLYIVTEFAKNGEMFDYLTSNG
DDB0231454_Ddis  ILKQLY-----HPFINKLLNVLEKD------------DAMFILMDYCQGGDLFHYVNKFG
QSK_Spur         VMKLLS-----HPHIIRLYQVMETD------------RYMYLVTEYASGGEIFDHLISHG
SIK_Spur         IMKMLS-----HPNVIKLYQVMETK------------SMLYLVTEYASNGEMFD---THG
CG4290_Dmel      IMKRLK-----HPHIIKLYQVMETK------------NMIYIVSEYASQGEIFDYIAKYG
AqueK068_Aque    IMKQLD-----HPHIIKLYQVMNTT------------QWLYLVTEYASGGEIFDYLIQHR
AqueK069_Aque    ILKQLCEGHFEHDYICRVLDVCIDRSPVLNGSGVVLGRIQFVVFEYCSGSDLFNFLCSGP
                 ::* :      *  : :  ::                   ::: ::.  .:::.

SIK_Hsap         --------------------HLSENEARKKFWQILSAVEYCHDHHIVHRDLKTENLLLDG
QSK_Hsap         --------------------RMAEKEARRKFKQIVTAVYFCHCRNIVHRDLKAENLLLDA
QIK_Hsap         --------------------RLNESEARRKFWQILSAVDYCHGRKIVHRDLKAENLLLDN
CG15072_Dmel     --------------------RMKEPEAARVFTQLVSAVHYCHRRGVVHRDLKAENVLLDK
kin-29_Cele      -------------------GRVAENVARKWFSETASAVAYLHSQGIVHRDLKAENILLGK
QIK_Mmus         --------------------RLNESEARRKFWQILSAVDYCHGRKVVHRDLKAENLLLDN
QSK_Mmus         --------------------RMAEKEARRKFKQIVTAVYFCHCRNIVHRDLKAENLLLDA
SIK_Mmus         --------------------HLSENEARQKFWQILSAVEYCHNHHIVHRDLKTENLLLDS
DDB0231454_Ddis  LKGVKMVNSPDIGDQVLMGVPLPEDDTKRIFTQICLGIAHCHKLNIAHRDIKHKNILFDN
QSK_Spur         --------------------KMTEREARQKFKQIVAAVHYCHKRGIVHRDLKAENLLLDA
SIK_Spur         --------------------RMSEKEAKKKFMQIIAAVEYCHKRHVVHRDLKAENLLLDG
CG4290_Dmel      --------------------RMSESAARFKFWQIISAVEYCHKKGIVHRDLKAENLLLDL
AqueK068_Aque    --------------------KMTESEARKKFKQIVMAVDYCHSRGIVHRDLKAENLLLDE
AqueK069_Aque    WEKH------------RKVSNFSEPLARHYFKQVLLGVMYLHERGMYHRDIKPENCVLDD
                                      . *  :   * :   .: . *   : ***:* :* ::.

SIK_Hsap         NMDIKLADFGFGNFYKSGEPLS------TWCGSPPYAAPEVFEGKEYEGPQLDIWSLGVV
QSK_Hsap         NLNIKIADFGFSNLFTPGQLLK------TWCGSPPYAAPELFEGKEYDGPKVDIWSLGVV
QIK_Hsap         NMNIKIADFGFGNFFKSGELLA------TWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVV
CG15072_Dmel     DMNIKLADFGFSNHYEEGATLK------TWCGSPPYAAPEVFQGLEYDGPKSDIWSLGVV
kin-29_Cele      NSNIKIIDFGFSNFQTGDQLLN------TWCGSPPYAAPELLLGNSYDGMKADIWSMGVL
QIK_Mmus         NMNIKIADFGFGNFFKTGELLA------TWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVV
QSK_Mmus         NLNIKIADFGFSNLFTPGQLLK------TWCGSPPYAAPELFEGKEYDGPKVDIWSLGVV
SIK_Mmus         NMDIKLADFGFGNFYKPGEPLS------TWCGSPPYAAPEVFEGKEYEGPQLDVWSLGVV
DDB0231454_Ddis  QMNVKIIDFGLSNWSYQE--KM------SFCGTPAYAAPEMLLGINYNGPEVDIWSLGVI
QSK_Spur         NMNVKIADFGFSNFFEKDHLLK------TWCGSPPYAAPELFEGREYNGPKADVWSLGVV
SIK_Spur         NMNIKIADFGFSNFFVPGEHLA------TWCGSPPYAAPEVFEGQKYDGPQLDIWSLGVV
CG4290_Dmel      NMNIKIADFGFSNHFKPGELLA------TWCGSPPYAAPEVFEGKQYTGPEIDIWSLGVV
AqueK068_Aque    NSNVKLADFGFSNSFKNEELLK------TWCGSPPYAAPELFEGKEYSGPQADIWSLGVV
AqueK069_Aque    NLNLKLTDFGTNKYFADADPMKLIRTKTRGVGTETYRAPEVNSGLDYDPAAADVWSLGVT
                 : ::*: *** .:                  *: .* ***:  * .*     *:**:**

SIK_Hsap         LYVLVCGSLPFDG-PNLPT-------------------------------LRQRVLEGRF
QSK_Hsap         LYVLVCGALPFDG-STLQN-------------------------------LRARVLSGKF
QIK_Hsap         LYVLVCGALPFDG-PTLPI-------------------------------LRQRVLEGRF
CG15072_Dmel     LYALVCGALPFDG-KTILE-------------------------------LKSRVVLGKF
kin-29_Cele      LYILVAGGFPFPS-DSVNK-------------------------------LKRSVLSGLV
QIK_Mmus         LYVLVCGALPFDG-PTLPI-------------------------------LRQRVLEGRF
QSK_Mmus         LYVLVCGALPFDG-STLQN-------------------------------LRARVLSGKF
SIK_Mmus         LYVLVCGSLPFDG-PNLPT-------------------------------LRQRVLEGRF
DDB0231454_Ddis  LYSLVTGKLPFIN-VT-------------------------------------DMIVGKF
QSK_Spur         LYVLVSGALPFDG-KTLHN-------------------------------LRARVLSGQF
SIK_Spur         LYVLVCGALPFDA-NTLPQ-------------------------------LKERVLAGKF
CG4290_Dmel      LYVLVCGALPFDG-STLQS-------------------------------LRDRVLSGRF
AqueK068_Aque    LYVMVCGALPFDG-NNLQH-------------------------------LRARVLAGRF
AqueK069_Aque    LFFFVGVEQMFAKVQTLDSYSKQIIAPLGIYFPFPLHCSKLDSYLRREADLRGRGVNGSL
                 *: :*     *    .                                       : * .

SIK_Hsap         R---------------IPFFMSQDCESLIRRMLVVDPARRITIAQIRQHRWMRAEP-CLP
QSK_Hsap         R---------------IPFFMSTECEHLIRHMLVLDPNKRLSMEQICKHKWMKLGD-ADP
QIK_Hsap         R---------------IPYFMSEDCEHLIRRMLVLDPSKRLTIAQIKEHKWMLIEV-PVQ
CG15072_Dmel     R---------------IPFFMSQECEQLIRNMLVVEPDRRYTIKQIIKHRWLSEWQ-SEM
kin-29_Cele      K---------------IPYWVSVECADFIRKMLVLNPGKRYTIQNVLQHRWMHIRD-DVQ
QIK_Mmus         R---------------IPYFMSEDCEHLIRRMLVLDPSKRLSIAQIKEHKWMLIEV-PVQ
QSK_Mmus         R---------------IPFFMSTECEHLIRHMLVLDPNKRLSMEQICRHKWMKLGD-ADP
SIK_Mmus         R---------------IPFFMSQDCETLIRRMLVVDPAKRITIAQIRQHRWMQADP-TLL
DDB0231454_Ddis  I---------------LPPSIPLDLQDLIKKMLTVDREHRLNIMNVLNHPWLSKDP-ASS
QSK_Spur         R---------------IPFFMSEGCEDLIRHMLILDASRRYTTDQVLNHRWTKGDG-PDP
SIK_Spur         R---------------IPFFMSQECEHLIRHMLVINPAKRLSIDQIKNHKWFADCGVPAT
CG4290_Dmel      R---------------IPFFMSSECEHLIRRMLVLEPTRRYTIDQIKRHRWMCPEL-LEH
AqueK068_Aque    R---------------IPFYMSEECEKLIRKMLQLDPSKRIPLSKVLEHKWMQATP-TTV
AqueK069_Aque    KGSALPNESFWSEWECLKVSISPGLRDLLNRIFVLDAGLRITLRDILRHPWVTMED-GMS
                                 :   :.     ::..:: ::   *    .: .* *

SIK_Hsap         GP-A----------------CP--AFS-------------A-HSYT--SNLGDYDEQALG
QSK_Hsap         NF-DR-----------LI--AE--CQQ---------------LKEE--RQVDPLNEDVLL
QIK_Hsap         RP-V----------------LY--PQE---------------QENE--PSIGEFNEQVLR
CG15072_Dmel     QE-QERFGDMSPGSGTVSKSAS--TSS-------------L-GSAS--DSPPQLDSVVMT
kin-29_Cele      KNQAA-----------QL--LEAIPSS-------------S-IEIR--QQSTKLNPTIMM
QIK_Mmus         RP-I----------------LY--PQE---------------QENE--PSIGEFNEQVLR
QSK_Mmus         NF-DR-----------LI--AE--CQQ---------------LKEE--RQSDPLNDDVLL
SIK_Mmus         QQ-D----------------DP--AFD-------------M-QGYT--SNLGDYNEQVLG
DDB0231454_Ddis  TL-I----------------S---QNLLHSPPVVHQPQPPQHQKIQPTSIIPNFNE----
QSK_Spur         VF-DK-----------MF--AE--H-N---------------V-QS--NQEEPVNELILQ
SIK_Spur         QP-V----------------S-----P-------------V-TEIP--KPIGEFNEQALR
CG4290_Dmel      V--L----------------IA--KYN-------------L-GAER--QTSVEPSEDILR
AqueK068_Aque    EG-PS-----------PL--RS--SPL-----------Y-P-QKTA--SGNLLWNEQVLL
AqueK069_Aque    PDIIK-----------ME--MENRCPS-------------A-IRMS--RDASPLL---VG


SIK_Hsap         IM---QTLG-VDRQRTVESLQNSS------------------------------------
QSK_Hsap         AME---DMG-LDKEQTLQSLRSDA------------------------------------
QIK_Hsap         LM---HSLG-IDQQKTIESLQNKS------------------------------------
CG15072_Dmel     HML--QLPG-LTADMIAQSVHEQR------------------------------------
kin-29_Cele      FM---QQHGKWSEEQIIDAVLGRD------------------------------------
QIK_Mmus         LM---HSLG-IDQQKTVESLQNKS------------------------------------
QSK_Mmus         AME---DMG-LDKERTLQSLRSDA------------------------------------
SIK_Mmus         IM---QALG-IDRQRTIESLQNSS------------------------------------
DDB0231454_Ddis  ----------------VETLKNNI------------------------------------
QSK_Spur         HMV---SMG-LKTEAIMQSITNQS------------------------------------
SIK_Spur         LM---QSLG-IDQQKTIDSLRRDA------------------------------------
CG4290_Dmel      IMA--EYVG-IGSDKTRASLKKNT------------------------------------
AqueK068_Aque    AIQRLQSSN-FSIEAVKQAVLKKQ------------------------------------
AqueK069_Aque    SK---L-LGGVDRVVLRESLSGANKEDIAFPEDSEIWQWSLQIEHLESLQLRISGGDAQE
                                   ::

SIK_Hsap         -------------------------------Y-NHFAAIYYLLLERLKEYRNAQCAR-PG
QSK_Hsap         -------------------------------Y-DHYSAIYSLLCDRHKRHKTLRLGALP-
QIK_Hsap         -------------------------------Y-NHFAAIYFLLVERLKSHRSSFPVEQRL
CG15072_Dmel     -------------------------------F-DNIYAIYNLLHDKLQQRRRENQRLQHH
kin-29_Cele      -------------------------------FESPIFATYELLADKVKKGTLEGTG-EEF
QIK_Mmus         -------------------------------Y-NHFAAIYFLLVERLKSHRSSFPVEQRL
QSK_Mmus         -------------------------------Y-DHYSAIYSLLCDRHKKHKTLRPGALP-
SIK_Mmus         -------------------------------Y-NHFAAIYYLLLERLKEHRSAQPSSRPT
DDB0231454_Ddis  -------------------------------L-NNN-------------------NNNN-
QSK_Spur         -------------------------------Y-DENSAIYHLLLDKHRRHLKAAEESQSA
SIK_Spur         -------------------------------Y-DHYTAIYYLLVERLRLHRCSFPVEGRV
CG4290_Dmel      -------------------------------Y-DHVAAIYLLLQDRVSHKKEQSNGLGAS
AqueK068_Aque    -------------------------------Y-NDQAALYYMLLHKWEKGQLQIPLNPLV
AqueK069_Aque    VMMDLNITLELVRNVLKEPANERHRQVMVDHISNEWIAQLFLIVGFLPKDNSLVLLDEYL
                                                  .

SIK_Hsap         PAR--QP-----------------------------------------------------
QSK_Hsap         SM-PRAL--AF----------QA-----------------------------------PV
QIK_Hsap         DGRQRRP-----------------------------------------------------
CG15072_Dmel     ASLAYS------------------------------------------------------
kin-29_Cele      PRRGSR------------------------------------------------------
QIK_Mmus         DGRQRRP-----------------------------------------------------
QSK_Mmus         SM-PQAM--TF----------QA-----------------------------------PV
SIK_Mmus         PAPTRQP-----------------------------------------------------
DDB0231454_Ddis  --NNN-------------------------------------------------------
QSK_Spur         AA-LYAL--AL----------GE-------------------------------------
SIK_Spur         DVRSRRP-----------------------------------------------------
CG4290_Dmel      -ALASST--SASRMIYSSRNDHQ-----------------------------------PT
AqueK068_Aque    SQ----L--SY----------QG-------------------------------------
AqueK069_Aque    DLNLLNCAVSY----------LQGIELAVTRAAIYTQCTDDGNSEGFEEDMEMEAGVMPL


SIK_Hsap         ----RPRSSDLSG----------------------------L-EVP-------------Q
QSK_Hsap         NIQ-AEQAGTAMN----------------------------I-SVP-------------Q
QIK_Hsap         --------STIAE----------------------------Q-TVA-KAQ---------T
CG15072_Dmel     ----RSRKTSITT----------------------------G-VVD-RSE----------
kin-29_Cele      -------GSILSG----------------------------K-ANV-DEQ---------P
QIK_Mmus         --------STIAE----------------------------Q-TVA-KAQ---------T
QSK_Mmus         NLQ-AEQTGTAMN----------------------------L-SVP-------------Q
SIK_Mmus         ----QLRSSDLSS----------------------------L-EVP-------------Q
DDB0231454_Ddis  ---------NN-------------------------------------------------
QSK_Spur         GVA-AQRNLMLGD----------------------------Q-MIP-------------Q
SIK_Spur         --------SSIAD----------------------------H-AIM-RTH----------
CG4290_Dmel      QQQSQQQSKTIST----------------------------S-SILAKDQCHKRLSRHQT
AqueK068_Aque    ----RYSTSSLAS----------------------------FSGVP-------------R
AqueK069_Aque    EEEEEEEITTFRDSVTLRGESVTEYDTSSSQSFFNNPISTTA-TAS-GSD---------P


SIK_Hsap         -------------------------------EGLSTD-----------------------
QSK_Hsap         ------------------------------------------VQ----------------
QIK_Hsap         -------------------------------VGLPVTMHSPNMR----------------
CG15072_Dmel     ----------------------------------PVKQESL-------------------
kin-29_Cele      -------------------------------LTPTISAHQ--------------------
QIK_Mmus         -------------------------------VGLPVTLHPPNVR----------------
QSK_Mmus         ------------------------------------------VQ----------------
SIK_Mmus         -------------------------------EILPCD-----------------------
DDB0231454_Ddis  ------------------------------------------------------------
QSK_Spur         ------------------------------------------VN----------------
SIK_Spur         -------------------------------AGTLTNIN-PHQR----------------
CG4290_Dmel      VLMSERNAHAGATPTVPDPGPGYYAKYGPLQLPLPLTGHSHLTGYLNGGGVEVDASGIPL
AqueK068_Aque    ------------------------------------------IN----------------
AqueK069_Aque    -------------------------------LTIPISMHQ--------------------


SIK_Hsap         P--FRPA--LLCPQPQ--------------------------------------------
QSK_Hsap         L-----------------------------------------------------------
QIK_Hsap         L--LRSA--L-LPQAS--------------------------------------------
CG15072_Dmel     -DRLSPL--------SNANASSSALG----------------------------------
kin-29_Cele      ------------------------------------------------------------
QIK_Mmus         L--MRST--L-LPQAS--------------------------------------------
QSK_Mmus         L-----------------------------------------------------------
SIK_Mmus         P--FRPS--LLCPQPQ--------------------------------------------
DDB0231454_Ddis  ---NNNN--ILN------------------------------------------------
QSK_Spur         V-----------------------------------------------------------
SIK_Spur         NTNARNA--IQVQQQPCVNTSQQMLGFR--------------------------------
CG4290_Dmel      PMRYTPLPTAASPAPSNCSSTSSRVGRHSLSSSSPRSHRPVAISLSIDNNPSLANLRCRE
AqueK068_Aque    I-----------------------------------------------------------
AqueK069_Aque    ------------------------------------------------------------


SIK_Hsap         -------------TLVQSVLQ----------------AEMDCE--LQSS-----------
QSK_Hsap         ------------------------------------------------------------
QIK_Hsap         -------------NVEAFSF-----------------PASGCQ--AEAA-----------
CG15072_Dmel     -----------------FG-W------------------SDVA--VDL----------EK
kin-29_Cele      --------------LAQLNL-----------------SSPDCD--SDDS-----------
QIK_Mmus         -------------NVEAFSF-----------------PTSSCQ--AEAA-----------
QSK_Mmus         ------------------------------------------------------------
SIK_Mmus         -------------ALAQSVLQ----------------AEIDCD--LHSS-----------
DDB0231454_Ddis  ------------------------------------------------------------
QSK_Spur         ------------------------------------------------------------
SIK_Spur         -------PIQPVQQPTQQIVS----------------ESAQCA--LQRKRKEPPLQPSTC
CG4290_Dmel      MMEAGGGPVGAVG----VP-LASKQLHQTISEFIIKQSTEDCRALLQQ----------ST
AqueK068_Aque    ------------------------------------------------------------
AqueK069_Aque    --------------FYNRSI-----------------SSNE------DN-----------


SIK_Hsap         -LQ------------WPLFFPVDASCSGVFRPR--------PVSPSS-------------
QSK_Hsap         ------------------INPENQ--IVEPDGT---------------------------
QIK_Hsap         -FMEEECVDTP-KVNGCLLDPVPP--VLVRKGC--------QSLPSN-------------
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      ----------------------------------------------S-------------
QIK_Mmus         -FMEEECVDTP-KVNGCLLDPVPP--VLVRKGC--------QSLPSS-------------
QSK_Mmus         ------------------INPENQ--IIEPDGA---------------------------
SIK_Mmus         -LQ-------------PLLFPLDTNCSGVFRHR--------SISPSS-------------
DDB0231454_Ddis  ------------------------------------------------------------
QSK_Spur         ------------------TNEDNQ--VIQSNDQ---------------------------
SIK_Spur         IFSEGEMVPVPPAVSGTLLEPLPR--MNVRKVR--------SMSPNH-------------
CG4290_Dmel      AVAEGK-DDP-PKAESSV-GGVPP--PA-------------STTPTSSTAGPESGSAPCP
AqueK068_Aque    ------------------DG----------------------------------------
AqueK069_Aque    -M-----------------------------SQGLCLLFFICTCMYC-------------


SIK_Hsap         ------------------------------------------------------------
QSK_Hsap         ------------------------------------------------------------
QIK_Hsap         ------------------------------------------------------------
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      ------------------------------------------------------------
QIK_Mmus         ------------------------------------------------------------
QSK_Mmus         ------------------------------------------------------------
SIK_Mmus         ------------------------------------------------------------
DDB0231454_Ddis  ------------------------------------------------------------
QSK_Spur         ------------------------------------------------------------
SIK_Spur         ------------------------------------------------------------
CG4290_Dmel      GEINGKTIKTMSSSSSFDSKANLGQSFRYKMSAEASKLFQTLQESPLPVEQRTKRRVHVG
AqueK068_Aque    ------------------------------------------------------------
AqueK069_Aque    ------------------------------------------------------------


SIK_Hsap         ------------------------------LLDTAIS--EEAR-QG-PGL----EEEQDT
QSK_Hsap         ----------------------------------------LN-LDSDEGE----EPSPEA
QIK_Hsap         ------------------------------MMETSID--EGLETEG-EAE----EDPAHA
CG15072_Dmel     ----------------------------------YGD--FELECLA-RS-----NDPPVN
kin-29_Cele      ------------------------------NSDLCDD-SPMS-SMG-PMNHERQFGTPHG
QIK_Mmus         ------------------------------MMETSID--EGLETEG-EAE----EDPSQA
QSK_Mmus         ----------------------------------------VN-LDSDEGE----EPSPEA
SIK_Mmus         ------------------------------LLDTAIS--EEAR-QG-PSL----EEEQEV
DDB0231454_Ddis  ------------------------------------------------------------
QSK_Spur         ----------------------------------------LEEMDS-DPE----EPSPEA
SIK_Spur         ------------------------------MVVTSID--EGVEADL-PES----ENEMEK
CG4290_Dmel      STNGSGGDSGQETNDAKSNGDSRSEKKVLAQGSSSTD--EGCETDQ-G------NDPGSA
AqueK068_Aque    ------------------------------------------------------------
AqueK069_Aque    ------------------------------IIETAIASSQES-MWA-PGSVSTQ-SSQ--


SIK_Hsap         QESLP---------------------------S--STG-----------RRHTLAEVSTR
QSK_Hsap         LV-------------------------------RYLSM-----------RRHTVGVADPR
QIK_Hsap         FEAFQ---------------------------STRSGQ-----------RRHTLSEVTNQ
CG15072_Dmel     AQHLSAHAGGG---------------------VNGANT-----------RRHTVGPGD--
kin-29_Cele      LDII----------------------------GNRFEN-----------RRHTLCASEQL
QIK_Mmus         FEAFQ---------------------------ATRSGQ-----------RRHTLSEVTNQ
QSK_Mmus         LV-------------------------------RYLSM-----------RRHTVGVADPR
SIK_Mmus         QEPLP---------------------------G--STG-----------RRHTLAEVSTH
DDB0231454_Ddis  ---------------------------------SNNNN-----------NNNNNNNSNNN
QSK_Spur         LA-------------------------------RYLQI-----------RRNTVIPGDPS
SIK_Spur         VGSME---------------------------H-FKSQ-----------RTHSLAESYDI
CG4290_Dmel      SQESKGSNGGGSGNANGGPTSHSSSDLTRLVGTTTSGQSH---------KMRSYASSSSS
AqueK068_Aque    ------------------------------------------------------------
AqueK069_Aque    -DDL-----------------------------PDGYQ-LVHEWNVDFSPWHRLIELSST


SIK_Hsap         LS-PLT-APCIVVSPSTTASPAEGTSSDS-CLTF-SASKSPAGLSGT--PATQGLL----
QSK_Hsap         TE-VME-DLQKL-------LPGFPG-VNP-QAPFLQVAPNVNFMHNL--LPMQNLQPTGQ
QIK_Hsap         LV-VMP-GAGKIFSMN--DSPSLDS-VDS-EYDMGSVQRDLNFLEDN--PSLKDIM----
CG15072_Dmel     ---------VAHEQAL--ANPNVPP-IDF-KCP-------------------PQ------
kin-29_Cele      LS-PN-------------------------------------------------------
QIK_Mmus         LV-VMP-GAGKMFSMS--DNPSLES-VDS-EYDMGSAQRDLNFLEDS--PSLKDIM----
QSK_Mmus         TE-VME-DLQKL-------LPGFPG-VNP-QGPFLQVAPNMNFTHNL--LPMQSLQPTGQ
SIK_Mmus         FS-PLN-PPCIIVSSSATASPSEGTSSDS-CLPF-SASEGPAGLGSG--LATPGLL----
DDB0231454_Ddis  NI-INNSNN---------NSNNNNN-INNNINNNNNVNNNVNNNKNN--NNN--------
QSK_Spur         GHKVPA-ALRAK-------LPAPPQ-LAG-MGLGGPCISDLTLLNNA--FN---------
SIK_Spur         QT-SMA-PSLSDFGIE--PQELSAS-FDS-QEEMEVA-QSFAHV-----QALSD------
CG4290_Dmel      SG-VLA-GSAGSYSKS--LSQNLSR-GSS-KSNCSGPYDSLDFALPSGKGSLPSCM----
AqueK068_Aque    --------------------------VGS-SSGSMGIVPWQNF------------HG---
AqueK069_Aque    LQ-IH-------------------------------------------------------


SIK_Hsap         -------GACSP------------------------------------------------
QSK_Hsap         LEYKEQSLLQPPTLQLL------NGMGPLGRRASDGGANIQLHAQQLLKR----------
QIK_Hsap         -------LANQPS-----------------------------------------------
CG15072_Dmel     --CS---DPTQPVPYYPVNLPMLQNQ----------------------PLH---------
kin-29_Cele      ------------------------------------------------------------
QIK_Mmus         -------LANQPS-----------------------------------------------
QSK_Mmus         LEYKEQSLLQPPTLQLL------NGMGPLGRRASDGGANIQLHAQQLLKR----------
SIK_Mmus         -------GTSSP------------------------------------------------
DDB0231454_Ddis  ---NNNNSN----------------------NNSNNGNN----------I----------
QSK_Spur         --LQEQNLLKPPVLEAT------AGQSSFGRRASDGGANMYLNIQQFRKQ----------
SIK_Spur         --------RLFP------------------------------------------------
CG4290_Dmel      --GSSS-MLATPTPASA-SPAGISSE----------------------HSSERSLYGSHN
AqueK068_Aque    ------------------------------------------------------------
AqueK069_Aque    ------------------------------------------------------------


SIK_Hsap         ----------VRLASPFLGSQSA-TPV---------------------------------
QSK_Hsap         ----------PRGPSPLVTMTPA-VPAVTPVD-EESSDGEPDQEAVQRYLANRSKRHTLA
QIK_Hsap         ----------PRMTSPFISLRPT-NPA---------------------------------
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      ------------------------------------------------------------
QIK_Mmus         ----------PRMTSPFISLRPA-NPA---------------------------------
QSK_Mmus         ----------PRGPSPLVTMTPA-VPAVTPVD-EESSDGEPDQEAVQRYLANRSKRHTLA
SIK_Mmus         ----------VRLASPFLGSQSA-TPV---------------------------------
DDB0231454_Ddis  ----------PNSSNNT-------------------------------------------
QSK_Spur         ----------LQ--TTVRTSQPGDIDATGQVQEDENSDGEPDEEAIRRYLDKGRCRHTIG
SIK_Spur         ----------SNCNSPDLTQQQT-EPM---------------------------------
CG4290_Dmel      SCIHMPGALPLGLGLPQSSASTP-TP----------------------------------
AqueK068_Aque    -----------------PS-------LAPPTM-NNASDSTMDA-NLQRY-LNQGRRHTLG
AqueK069_Aque    ------------------------------------------------------------


SIK_Hsap         ------------------------------------------------------------
QSK_Hsap         MTNPTAEIPPDLQRQLGQ---QPFRSR----------------VWPPHLVPDQHRST---
QIK_Hsap         ------------------------------------------------------------
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      ------------------------------------------------------------
QIK_Mmus         ------------------------------------------------------------
QSK_Mmus         MTSPTAEIPPDLQRQLGQ---QSFRSR----------------VWPPHLVPDQHRST---
SIK_Mmus         ------------------------------------------------------------
DDB0231454_Ddis  ----NSIINNNLY-----------------------------------------------
QSK_Spur         PDVLTNNDMPLVSR-------------------------------------PRHNRF---
SIK_Spur         -----------------------------------IP-----------------PP--AP
CG4290_Dmel      ------------------------------------------------------NP--TP
AqueK068_Aque    TAHNMLIIPPEDMNRLRKINESSSSQASSGFGSSSTNVPPVHPEMQPHIIPTLSTGIEE-
AqueK069_Aque    ----------------------------------------------------------E-


SIK_Hsap         -----LQAQGGLGGA--VLLP-VS---FQEGRRASDTSLTQGLKAFR-QQL---------
QSK_Hsap         ----------YKDSNT-LHLPTER---FSPVRRFSDGAA--SIQAFK-AHL---------
QIK_Hsap         -----MQALSSQKREVHNRSP-VS---FREGRRASDTSLTQGIVAFR-QHL---------
CG15072_Dmel     -------NLT-IKDQHLLKPP-VVMGASSFGRRASDGGANLHIY----------------
kin-29_Cele      ------------------------------------------------------------
QIK_Mmus         -----MQALSSQKREAHNRSP-VS---FREGRRASDTSLTQGIVAFR-QHL---------
QSK_Mmus         ----------YKDSNT-LHLPTER---FSPVRRFSDGAA--SIQAFK-AHL---------
SIK_Mmus         -----LQTQAGLGTA--VLPP-VS---FQEGRRASDTSLTQGLKAFR-QQL---------
DDB0231454_Ddis  -----NQSLSPQNNNIYQHSP-QHQ---QHQHQQQHSPQ---------------------
QSK_Spur         ----------LQPERS-LHLFAS-----TNARRASDGMP--NLQYYQRERL---------
SIK_Spur         P-QAMFQHSASLDR-SGSHSP-VS---FREGRRASDGLIAQTGLSYR-QVSPTPLAQ---
CG4290_Dmel      ------PPNGGGVTFLDKRSP-IH---FREGRRASDGLVAQGLLSSG-SLLGTSRVYGSY
AqueK068_Aque    PKTSIG-SIVSSSRQF-LQLP-RF---FSSKRRASDGGH--YLEAYR-QFL---------
AqueK069_Aque    PKQYRAA----------------------------------------A-EF---------


SIK_Hsap         -RKTT---------RTKG-----------------FLGLNK-IKGLARQV-CQ-------
QSK_Hsap         -EKMG---------NNS-----------------SIKQLQQECEQLQKMY-GGQ-I----
QIK_Hsap         -QNLA---------RTKG-----------------ILELNK-VQLLYEQI-GPE-A----
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      ------------------------------------------------------------
QIK_Mmus         -QNLA---------RTKG-----------------ILELNK-VQLLYEQM-GSN-A----
QSK_Mmus         -EKMG---------NSS-----------------SIKQLQQECEQLQKMY-GGQ-V----
SIK_Mmus         -RKNA---------RTKG-----------------FLGLNK-IKGLARQV-CQ-------
DDB0231454_Ddis  ---QQ---------QHQ-----------------QHQHHQQQQQQLQQQH-HQQ-H----
QSK_Spur         -ERLAATGGGSSSSQKS-----------------SLKQLHKECQQLQKQF-SSP-I----
SIK_Spur         GHKDA---------SLDGHLKT-------------NLNMNS-CSLAADQL----------
CG4290_Dmel      RYEQA---------KRHG-----------------WLEIQQ-LQQLQQEA-AVGHSHPHA
AqueK068_Aque    -HKRS---------STMYSHQASVEGGVVSAQPTTAKQLLQEKIETDRLY-GR--L----
AqueK069_Aque    -CK---------MS----------------GLLCSYGLYQVVCHDQLAMYCRGN-I----


SIK_Hsap         ---------------------------APA-----S--RASRG------G-L--------
QSK_Hsap         ------DERTLEKTQQQHMLYQQEQH-HQILQQQIQD------SICP-PQ-PSPPLQAAC
QIK_Hsap         ------DPNLAPAAPQLQDLASSCPQ-EEVSQQQES-VSTLPA------S-V--------
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      -------------------------------------------MMGQ-FP----------
QIK_Mmus         ------DPTLTSTAPQLQDLSSSCPQ-EEISQQQES-VSSLSA------S-M--------
QSK_Mmus         ------DERTLEKTQQQHMLYQQEQH-HQILQQQIQD------SICP-PQ-PSPPLQVAC
SIK_Mmus         ---------------------------SSV--------RTPRG------G-M--------
DDB0231454_Ddis  ------HQQ-HQQHQQQHQQQHQQQ-HQ-QHQQHQQS------HQQP-PV--YFPTQIIS
QSK_Spur         ------DARA--------------------------------------------------
SIK_Spur         -----------------QIVGFSGQQLTEVSKDNAD-LTNLPS------CQV--------
CG4290_Dmel      HQHPHQHPHPHPQAYGLEELC----Q-FP----NGQ-FYALPG------K-H--------
AqueK068_Aque    ------PRQKLP--HNPHLLSSSGLESSNIIAQMVQPVQPLTSSTLPLPV-PMANLREQC
AqueK069_Aque    ------ASFSMR------------------IVNQIVD------GLCK-VF-ISTWC--MC


SIK_Hsap         ------------------------------------------------------------
QSK_Hsap         ENQPALLTHQLQRLR----IQPSSPPPNHPNNHLFRQPSN--SPP-PMSSAMIQPHGAAS
QIK_Hsap         ------------------------------------------------------------
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      -------------------------PPNLLLNNFSMNPPLGF--P-PMPEG---QAAEFP
QIK_Mmus         ------------------------------------------------------------
QSK_Mmus         ENQPALLTHQLQRLR----IQPSSPPPNHPSNHLFRQPSN--SPP-PVSSAMITSHGATS
SIK_Mmus         ------------------------------------------------------------
DDB0231454_Ddis  DD--FNLTSQLQRT------QPNQQV-SFDTNQSYQQQLQ--QPQIP-------------
QSK_Spur         ------------------------------------------------------------
SIK_Spur         ------------------------------------------------------------
CG4290_Dmel      ------------------------------------------------------------
AqueK068_Aque    QPFH-DITQQQIREQ----LEQLHMSNGSPSDH------G--SLP-HAQSSGVASGGSST
AqueK069_Aque    GNDEWALV--LERLTLADRIDAF--QRCLA---DTDLPSINTSKP-TCSDHLLEIVAEYD


SIK_Hsap         ------------------------------------------------------------
QSK_Hsap         SSQFQGLPSRSAI---FQQQPENCSS--PPNVALTCLGMQQPAQSQQVTIQVQEPVDMLS
QIK_Hsap         ------------------------------------------------------------
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      LP-SLHPA--------FATI----------------------------------PIADLS
QIK_Mmus         ------------------------------------------------------------
QSK_Mmus         PSQFQGLPSHGAI---FQQQPENCSP--PPSVALTCLGLQQASQSQPVTIQLQEPVDMLS
SIK_Mmus         ------------------------------------------------------------
DDB0231454_Ddis  ---------HQVL---MQQPPQILSHSNNQPINNYYVGQQ--------------------
QSK_Spur         ------------------------------------------------------------
SIK_Spur         ------------------------------------------------------------
CG4290_Dmel      ------------------------------------------------------------
AqueK068_Aque    ----------SSI---N--SRKNSSG--NNSIIAQLLAATPPSASPSFPTQMVA-TSMAS
AqueK069_Aque    SKSPCGQLKRFAAYIELHDV----------------------------------PYEELS


SIK_Hsap         ------------------------------------------------------------
QSK_Hsap         NMPGTAAGSSGRGISISP-----------------------------------SAGQMQM
QIK_Hsap         ------------------------------------------------------------
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      K----------------------------------------------MLPVPK-------
QIK_Mmus         ------------------------------------------------------------
QSK_Mmus         NMAGTAAGSAGRSIPISP-----------------------------------SASQIQI
SIK_Mmus         ------------------------------------------------------------
DDB0231454_Ddis  ------------------------------------------------------------
QSK_Spur         ------------------------------------------------------------
SIK_Spur         ------------------------------------------------------------
CG4290_Dmel      ------------------------------------------------------------
AqueK068_Aque    SEYDGASTSNERRYSIQP-----------------------------------SP-----
AqueK069_Aque    SLTLSPAGDGDGGDEDSQSTLKEIAYHCYYDIDDRLCSDYNFCIDSSSLPVLYTRDA-CL


SIK_Hsap         ------------------------------------------------------------
QSK_Hsap         QHRTNLMATLSYGHRPLSKQLSADSAEAHSLNVNRFSPANYDQAHLHPH-----------
QIK_Hsap         ------------------------------------------------------------
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      -------------------------SERRASAGETLLPTNFDLTQH--------------
QIK_Mmus         ------------------------------------------------------------
QSK_Mmus         QHRASLMAPFSYGHRPLSKQLSADSAEAHSLNMNRFSPANYDQAHLHPH-----------
SIK_Mmus         ------------------------------------------------------------
DDB0231454_Ddis  ------------------------------------------------------------
QSK_Spur         ------------------------------------------------------------
SIK_Spur         ------------------------------------------------------------
CG4290_Dmel      ------------------------------------------------------------
AqueK068_Aque    --HSSLNPPVTRHHRKTLPDL-------HPQLIIVE-----PPANLHPQ-----------
AqueK069_Aque    MESSVLIAGESFNEKIYTYQMAV-AVIIESNYADKYNPAI-TQHYMHTCMEHYNDIEICL


SIK_Hsap         ------------------------------------------------------------
QSK_Hsap         ------LF--------------------------------------------------SD
QIK_Hsap         ------------------------------------------------------------
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      ------------------------------------------------------------
QIK_Mmus         ------------------------------------------------------------
QSK_Mmus         ------LF--------------------------------------------------SD
SIK_Mmus         ------------------------------------------------------------
DDB0231454_Ddis  ------------------------------------------------------------
QSK_Spur         ------------------------------------------------------------
SIK_Spur         ------------------------------------------------------------
CG4290_Dmel      ------------------------------------------------------------
AqueK068_Aque    ------AS--------------------------------------------------TS
AqueK069_Aque    FEIFHHCFTLEDVYYYTPYWCYYDVLTMMCSQFKGDEQLLCEVVLEARWELSLVSECTNE


SIK_Hsap         -------------------------------SPFHA-PAQ--------------------
QSK_Hsap         QSRGSPSSYSPSTG-VGFSPT-QALKVPPLDQFPTF-PPSAHQ-QPPHYTTSALQQALLS
QIK_Hsap         -------------------------------HPQLS-PRQ--SLE-TQYLQHRL------
CG15072_Dmel     ----------------------------------------------------------YP
kin-29_Cele      --------------------L-ANLPAPPI-SFPTV-EEEGKS-YLSKY-----------
QIK_Mmus         -------------------------------HPQLS-PQQ--SLE-TQYLQHRL------
QSK_Mmus         QSRGSPSSYSPSTG-VGFPPT-QALKVPPLDQFPTF-PPSAQQ-QPPHYTTSALQQALLS
SIK_Mmus         -------------------------------STFHT-PAP--------------------
DDB0231454_Ddis  -------------------PI-QQIQ--QLQQQQQL-QQQQQQ-QQQQ------QQQ---
QSK_Spur         ------------------------------------------------------------
SIK_Spur         ------------------------E--QELVSWRRF-PAQVQSMERRQYRMHAMKQGVHT
CG4290_Dmel      -------------------------------HPLLTLPHHHAHPAQHHHGHHSLFHSGHQ
AqueK068_Aque    SSLGES---SPESS-LGATANAIGRRSPPYFQV--G-SPGEVG-SPLHWQERQRKTGM-S
AqueK069_Aque    NNKGKC--EDIITGIVDTKPI-SQINSSDIDQMKAV--LSANS-RQLNYTNETLTQ--LS


SIK_Hsap         -S-------------------------------------P----GLHG------------
QSK_Hsap         PTPP---------DYTRHQ-------------Q-----VPHILQGLLSPRHSLTG-----
QIK_Hsap         QK-------------------------------------P----SLLSKAQ---------
CG15072_Dmel     ATGTVVGPAQGQQMDTAGY-------------YINPNCG---------------------
kin-29_Cele      ---------------------------------------------------------GGK
QIK_Mmus         QK-------------------------------------P----NLLPKAQ---------
QSK_Mmus         PTPP---------DYPRHQ-------------Q-----VPHILQGLLSPRHSLTG-----
SIK_Mmus         -S-------------------------------------S----GLQG------------
DDB0231454_Ddis  ----------------QQ------------------------------------------
QSK_Spur         ------------------------------------------------------------
SIK_Spur         EP-------------------------------------P----GHLTHSASLAG-----
CG4290_Dmel      ATPLLLEAAAGGDMYGHGC-------------YAPPPPPP----GLYTHHQLGVG-----
AqueK068_Aque    LQPS------------------------------------------------HLG-----
AqueK069_Aque    RIVE---------YFSLNQSAVSMIIDKQDANT-----FLSVISGLASEN---GTRSLME


SIK_Hsap         ----------------------------GAA------------------GSREGWSL--L
QSK_Hsap         -------------------HS-----D-IRL-----------PPTEFAQ----------L
QIK_Hsap         --------------------N-----T-CQL------------------YCKEPPRS--L
CG15072_Dmel     --------------------------T-DPL-----------AVQE--------LSP--L
kin-29_Cele      RNTVHCLGNQLGGGIQNPI-PRYQRTPYTKA-----------PPAE----RRSSWASPSL
QIK_Mmus         --------------------S-----P-CPV------------------YCKEPPRS--L
QSK_Mmus         -------------------HS-----D-IRL-----------PPAEFAQ----------L
SIK_Mmus         ----------------------------CTT------------------SNREGRSL--L
DDB0231454_Ddis  ---------------------------------------------QQQQ----------Q
QSK_Spur         ------------------------------------------------------------
SIK_Spur         -------------------QS-----S-LED-----------MPREFPNQMPPNPHT--L
CG4290_Dmel      -------------------M------A-VPM-----------SPMQ--------KPP--L
AqueK068_Aque    -------------------AS-----S-IEDDFCKGVTIPNLPDP-QSS----------I
AqueK069_Aque    SSSVKLKLNKTDTNS-SNMTA-----S-ILI-----------PPAS----IC------NS


SIK_Hsap         -EEVL-EQQ--------------------------------RL-----LQLQ--HHP---
QSK_Hsap         -IKRQ-QQQ--------------------------------R---Q-QQQQQ--QQQQEY
QIK_Hsap         -EQQL-QEH--------------------------------RL-QQKRLFLQ--KQSQLQ
CG15072_Dmel     NEQSV-AQM--------------------------------Q-CCQENATGE--CNEELQ
kin-29_Cele      -SAQQ-QNHLE------------------------------KLFKQALQTNN--DMTR-L
QIK_Mmus         -EQQL-QEH--------------------------------RL-QQKRLFLQ--KQSQLQ
QSK_Mmus         -IKRQ-QQH--------------------------------R---Q-QQQQQ--QQQQEY
SIK_Mmus         -EEVL-HQQ--------------------------------RL-----LQLQ--HHSSTA
DDB0231454_Ddis  -QQQQ-QQQ--------------------------------Q---QQQQQQQ--QQQQ-Q
QSK_Spur         ------------------------------------------------------------
SIK_Spur         -QRTL-LHQ--------------------------------RL-MQKRQQLQ--KQSQLS
CG4290_Dmel      -QQQL-LQH--------------------------------RLLQQKRQLFQ--KQYALE
AqueK068_Aque    --VPQ-PLQ--------------------------------Q---Q-QQQHD--ILQQSV
AqueK069_Aque    -DTVDDYGLEEEEEYDGSGEDYYYYYYDELCPKGVLNCTQDINGYEYVYYNLYELFGD-C


SIK_Hsap         AAAP---------------GCSQA------------------------------------
QSK_Hsap         QELFRHMNQGDAGSLAPSLGGQSM----------TER--QALSY-----QNADSYH---H
QIK_Hsap         -AYF---------------NQMQI----------AES--------------S-YP--Q--
CG15072_Dmel     -SYM---------------QKRGG----------T-Q--R-----------H-T------
kin-29_Cele      HKEFKGLSHGCAQSQITNEGSSLA----------CPQIS--IT---------DEYNRQ-H
QIK_Mmus         -AYF---------------NQMQI----------AES--------------S-YP--G--
QSK_Mmus         HELFRHMNQGDAVSLAPSLGGQNM----------TEQ--QALSY-----QNADSYH-R-H
SIK_Mmus         AASS---------------GCQQG------------------------------------
DDB0231454_Ddis  QQQQQQQQQQNDPNFQPHLRRIKM----------SKR--D-NSYNKRKSEDGDSYK-KRD
QSK_Spur         ------------------------------------------------------------
SIK_Spur         -QQF---------------GCMQL----------ERQ--------------S-SF--E--
CG4290_Dmel      -AQL---------------AGRHH----------HHQ--Q-----------H-SH--H-H
AqueK068_Aque    QQIPIFFNQH-ISLLNPNVANQ-------------------IAH-----QQMSSL--V-H
AqueK069_Aque    S-RKLKVPRSCPVVITTSIADSVSSLLSASLPENMTIASLVLSS-----Q--IVTRSE--


SIK_Hsap         ------------------------------------PQ-PAPAPF-V--IAP--------
QSK_Hsap         HTSP-------QHLLQIRA------QECVSQA----SS-PTPPHGYA--HQPALMHSESM
QIK_Hsap         ----------------------------PSQQLPLPRQ-ETPPPS-Q--QAP--------
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      NIAPSASSFDPVSIFQKNA------QEVVF-G----QR-PATAIGFS--STS--------
QIK_Mmus         ----------------------------PSQQLALPHQ-ETPLTS-Q--QPP--------
QSK_Mmus         HTSP-------QHILQIRA------QDCISQG----PS-PTPTHGYA--HQPPLMHSESM
SIK_Mmus         ------------------------------------PQ-LSPVPY-V--LAP--------
DDB0231454_Ddis  NQSY-------DDILKDEGNKRLRELQTYSEG----DK--------SRQHYNRDSNDNSR
QSK_Spur         ------------------------------------------------------------
SIK_Spur         ------------------------------------------------------------
CG4290_Dmel      H-----------------H------HFGHSLG----PP-PPPAP------AP--------
AqueK068_Aque    HIS---------------------------------------------------------
AqueK069_Aque    --------NNSTNVTQSLR------ENAML-Q----FKLLMPMNLTE--FVPKCYYWDTL


SIK_Hsap         -------------------------CDGP-------------------------------
QSK_Hsap         --------------------EEDCSCEGAKDGF-------Q-------------------
QIK_Hsap         -------------------------PF---------------------------------
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      ------------------------------------------------------------
QIK_Mmus         -------------------------SF---------------------------------
QSK_Mmus         --------------------EEDCLCEGLKEGF-------P-------------------
SIK_Mmus         -------------------------CD---------------------------------
DDB0231454_Ddis  DNNRYNNRDNNNNNNSNNNRERDRYKKNKNENFDYGKYKFGKSNEDEENKDKPNIVREKP
QSK_Spur         ------------------------------------------------------------
SIK_Spur         ---------------------------G--------------------------------
CG4290_Dmel      -------------------------EH---------------------------------
AqueK068_Aque    ------------------------------------------------------------
AqueK069_Aque    --------------------ENVWSDDG--------------------------------


SIK_Hsap         ----------GAAPLPS-------------------------------------------
QSK_Hsap         DSKSSSTLTKGCHDSP--------------------------------------------
QIK_Hsap         ------------------------------------------------------------
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      --------FSGM-STPEQTTRS---------------------------------IDDRV
QIK_Mmus         ------------------------------------------------------------
QSK_Mmus         D-KSSSTLTKGCHNSP--------------------------------------------
SIK_Mmus         ------------------------------------------------------------
DDB0231454_Ddis  DFKPSGSLKN--------------------------------------------------
QSK_Spur         ------------------------------------------------------------
SIK_Spur         -----------RPPAPN-------------------------------------------
CG4290_Dmel      ------------------------------------------------------------
AqueK068_Aque    NVLSSFKIVYQCSGNV--------------------------------------------
AqueK069_Aque    --------IETL-VLSDQDVLCNTSHLTSFAVLVDHQGLIESTNIPSAERKALSIVGYIG


SIK_Hsap         ---TLLT-------SGLPLLP----------PPLL---QT--------------------
QSK_Hsap         ---LLLS-------TGGPGDP----------ESLL---GT--------------------
QIK_Hsap         ---SLTQ-------PLSPVLE----------PSSE---QM--------------------
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      RSIVCTL-------PFTEVIDELKASLNILKIPFSESHEM--------------------
QIK_Mmus         ---SLTQ-------ALSPVLE----------PSSE---QM--------------------
QSK_Mmus         ---LLLC-------TSGPGDP----------EPLL---GT--------------------
SIK_Mmus         ---SLLV-------SGIPLLP----------TPLL---QA--------------------
DDB0231454_Ddis  -------------------DS----------SSNY---GT--------------------
QSK_Spur         ------------------------------------------------------------
SIK_Spur         -------------------RT----------DSYK---QA--------------------
CG4290_Dmel      ---HLADELYELALLDRPRSG----------TPRL---Q---------------------
AqueK068_Aque    ---FTIC-----------------------------------------------------
AqueK069_Aque    PGFSLLC-------LI----------IALVIMIALRKRMNTSFLYWIHLNLCISLLLALT


SIK_Hsap         ------------------------------------------------------------
QSK_Hsap         ------------------------------------------------------------
QIK_Hsap         ------------------------------------------------------------
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      ------------------------------------------------------------
QIK_Mmus         ------------------------------------------------------------
QSK_Mmus         ------------------------------------------------------------
SIK_Mmus         ------------------------------------------------------------
DDB0231454_Ddis  ------------------------------------------------------------
QSK_Spur         ------------------------------------------------------------
SIK_Spur         ------------------------------------------------------------
CG4290_Dmel      ------------------------------------------------------------
AqueK068_Aque    ------------------------------------------------------------
AqueK069_Aque    VLLVGLETAHHYNWLCSIVAGLLHYLFLCVFAWMLAEGITLFIMVVYVFGIKFLKWQIFI


SIK_Hsap         ------------------------------------------------------------
QSK_Hsap         ------------------------------------------------------------
QIK_Hsap         ------------------------------------------------------------
CG15072_Dmel     ------------------------------------------------------------
kin-29_Cele      ------------------------------------------------------------
QIK_Mmus         ------------------------------------------------------------
QSK_Mmus         ------------------------------------------------------------
SIK_Mmus         ------------------------------------------------------------
DDB0231454_Ddis  ------------------------------------------------------------
QSK_Spur         ------------------------------------------------------------
SIK_Spur         ----------------------------------------<