Protein (view, download) , Domain (view, download)
TAK1_Hsap        MSTASAASS---------------------------------------------------
Takl2_Dmel       MSAPV-------------------------------------------------------
Takl1_Dmel       MVKQ--------------------------------------------------------
Tak1_Dmel        MATASLDA----------------------------------------------------
mom-4_Cele       MDNSSQSKP---------------------------------------------------
TAK1_Mmus        MSTASAASS---------------------------------------------------
Y105C5A.24_Cele  MDRKPSSSS---------------------------------------------------
TAK1_Spur        MARLVTQ-----------------------------------------------------
AqueK667_Aque    MQHSRADDG---------------------------------------------------
AqueK668_Aque    MEVIA-------------------------------------------------------
AqueK669_Aque    MSNKAGEDV---------------------------------------------------
AqueK670_Aque    MN----------------------------------------------------------
AqueK671_Aque    MYRLQPAPPALMLSTAANTSPHGGPAKIRSVTLEQLPWSIVKKLTQLLDRTHPDHHNWSS
AqueK672_Aque    MSTQPGYDE---------------------------------------------------
AqueK673_Aque    MEVIA-------------------------------------------------------
AqueK674_Aque    MSKAEQGVK---------------------------------------------------
                 *

TAK1_Hsap        -------------------------------S----------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       -------------------------------S----------------------------
TAK1_Mmus        -------------------------------S----------------------------
Y105C5A.24_Cele  -------------------------------S----------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    -------------------------------ILRVMGELWVSTMVNGDLLSCGWIRSLEW
AqueK668_Aque    ------------------------------------------------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    LLSHAQVIGIKYTADEVANFQSVANRVAGSPS----------------------------
AqueK672_Aque    -------------------------------A----------------------------
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    VCPTCGVANRTALPEGSEEEA---------------------------------------
AqueK668_Aque    ------------------------------------------------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    -------------------EAIINDFIVRCVTTDDLYLILKDMEHKRGMELLEEYVSLRL
AqueK672_Aque    ------------------------------------------------------------
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ------------------------------------------------------------
AqueK668_Aque    ------------------------------------------------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    LPPNTKSSDSMRGGSAQGNGGGGEADQSRANGSNGLQYTYHPEVGPLPINVPNTVISTTV
AqueK672_Aque    ------------------------------------------------------------
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ------------------------------------------------------------
AqueK668_Aque    ------------------------------------------------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    LRVPQDQQHDNHHMPSNQFLINAHHHSSSPASQYQSQSPGIQSPGCFFSPVGDTPTAQFS
AqueK672_Aque    ------------------------------------------------------------
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ------------------------------------------------------------
AqueK668_Aque    ------------------------------------------------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    SPPPPPYSPLVHYPPSLDSSFHDSRAQRHYEGGGGVMMCSPQSHDGYHGTSPVFTPQTVP
AqueK672_Aque    ------------------------------------------------------------
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        ----------------SSSSA-------------------G-------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ----------------SSSSSHSP----------------S-------------------
TAK1_Mmus        ----------------SSSSA-------------------S-------------------
Y105C5A.24_Cele  ----------------T----GPP----------------A-------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ----------------RDTKIT----------------KEM-------------------
AqueK668_Aque    ------------------------------------------------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    SPWCERQLDGIVSRPSNSSTSSSPTNCTPSP---------SLSSAPSSVPSSAPSSLPPP
AqueK672_Aque    ----------------RPSHSI-V--GREGSGERLMEHGDH-------------------
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        ---------EMIEAPSQVL----------NFEEIDYKE----------------------
Takl2_Dmel       -------------------------------EGVPYEE----------------------
Takl1_Dmel       ---------------------------------VDFAE----------------------
Tak1_Dmel        ------------------L----------QAAYVDFSE----------------------
mom-4_Cele       ---------PAAITPTQRTTRDSGLCSTIDIPEIQAQCI---------------------
TAK1_Mmus        ---------EMIEAPSQVL----------NFEEIDYKE----------------------
Y105C5A.24_Cele  ---------PVI----QRKTRDSDLCLTSDIPKIPPNCI---------------------
TAK1_Spur        -----------------MS----------FKEEVEFND----------------------
AqueK667_Aque    ---------EDIVSQMAIK----------SQEEVDAQFKQQVQRQSEASHVPQPRPPSTD
AqueK668_Aque    -----------------------------------PNQ----------------------
AqueK669_Aque    ---------EEVVAGMEYP----------VIEEISLKF----------------------
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    SSSSSSAAASNNDIKLSIL----------RFSYADLSTA---------------------
AqueK672_Aque    ---------NKVFLPIGCP----------LVEEASMKF----------------------
AqueK673_Aque    -----------------------------------PNQ----------------------
AqueK674_Aque    ----------KVRLKIECP----------IIEETTLEF----------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    QSNRRNIDIKESHDEYKDEGGTEINKESSTSGIRYRGQEETDQPLPPPPSLSPPPLPPSV
AqueK668_Aque    ------------------------------------------------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    ------------------------------------------------------------
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        --IEVEEVVGRGAFGVVCK-AKWRA------KDVAIKQIESES---------------ER
Takl2_Dmel       --IQTKELIGTGFYGSVYR-AVWRN------REIALKRIREGC---------------ED
Takl1_Dmel       V-KLSEKFLGAGSGGAVRK-ATFQN------QEIAVKIFDFLEET-------------IK
Tak1_Dmel        --ITLREKVGHGSYGVVCK-AVWRD------KLVAVKEFFASA---------------EQ
mom-4_Cele       D-NLNSHYLGKGTYGLVEK-TRYRKTRQDDFRPAAIKYSSQL----------------HM
TAK1_Mmus        --IEVEEVVGRGAFGVVCK-AKWRA------KDVAIKQIESES---------------ER
Y105C5A.24_Cele  D-ELNSHFLGKGTFGVVEK-TKYRKT-----RD---------------------------
TAK1_Spur        --IDFEKVVGKGAFGVVSK-ASWRG------MNVAVKMIESEE---------------EI
AqueK667_Aque    S-RVDGSLIGIGSSDRVRF-ATHEG------RDVAVKYSILAR---------------EH
AqueK668_Aque    --LEDKLMLGSGAFGCVYQ-AKWRS------RPVAVKYFNSKTIG-------------DD
AqueK669_Aque    --KPENTLIGVGASGRVRF-ATHKG------RDVAVKYFRSVS---------------EK
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    TRIFTEGLVGHGAFGSVFR-ANIRGC-----GPYAIKKLHNRSEMQSEMEGTLFFEPLHQ
AqueK672_Aque    --KPDDEFLKKGSFGSIRHAATLEG------KDVAIKYFTSRD---------------IK
AqueK673_Aque    --LEDKLMLGSGAFGSVYK-AKWRS------RQVAVKYFNSKTIG-------------DD
AqueK674_Aque    --KPDQKFVEQGAYGRVCR-ATHEG------KDVAVKYFKSVE---------------EK


TAK1_Hsap        KAFIVELRQ---LSRVNHPNIVKLYGACLN----PVCLVMEYAEGGSLYNVLHGAEP-LP
Takl2_Dmel       KKIEREIYQ---LTKASHVNIVELYGTSRH--EGCALLLMEFVDGGSLSSFLHAKS--KP
Takl1_Dmel       KNAEREITH---LSEIDHENVIRVIGRASN--GKKDYLLMEYLEEGSLHNYLYGDD--KW
Tak1_Dmel        KDIEKEVKQ---LSRVKHPNIIALHGISSY--QQATYLIMEFAEGGSLHNFLHGKV--KP
mom-4_Cele       ATLIREAKVMWD--LRNHPNIIKIYGLYKSPR-NGQGVVMEYMDCGSMADLLYDRT--HI
TAK1_Mmus        KAFIVELRQ---LSRVNHPNIVKLYGACLN----PVCLVMEYAEGGSLYNVLHGAEP-LP
Y105C5A.24_Cele  -------------------DTYRIYGMYESHR-NGQGLVMEYMDCGCVADLIYDRK--NI
TAK1_Spur        KAFRVEVMQ---LSRVDHPNIVKLYGACTT--Q-PVCLVMEFAEGGSLYNVLHSSQP-QP
AqueK667_Aque    K-------ELEQ---EKHDNIAVLLGTGPN----ERFIIREFAP-YSLETVLHGSYPHCY
AqueK668_Aque    PCFEREIEALTHLQSLKHPNIIRMFARGTE--GPQTFIVMEVAL-FSLDKIIHDLKK-EY
AqueK669_Aque    EEFEQEVLNSKA--LQNHDNIVAILGTGPN----KLFIVREFAP-YSLNRVLHGSYPHRY
AqueK670_Aque    --------------TLRHPNVVLLLAASPS--PPKLAIVMEYVGGGSLYSHLHID---KT
AqueK671_Aque    ESFMLELQS---LVKYKHRNVLSLIAISDD--GPRPCLVYEYMENGSLADCLLGKK--NV
AqueK672_Aque    GGYNDELTILNA--LQTHDNIVVLLGAGLSPMTKEPFVVMEFAP-YSLNRVLHGY-PR-Y
AqueK673_Aque    PSFEREIEALTHLQSLKHPNIIRMFARGTE--GPQTFMVMEIAL-FSLDKIIHELKK-EY
AqueK674_Aque    RGYKQELVFLKC--LQEHENIVILYGTGSSPKTKEPYIVMEFAP-YSLERVLHGSHPHRY
                                    :   : .           :: *     .:   :

TAK1_Hsap        YYTAAHAMSWCLQCSQGVAYLHSM-QPKALIHRDLKPPNLLLVAGGT--VLKICDFGTAC
Takl2_Dmel       SYSHAHAFNWAHQIAQGIAYLHGM-QPKAVIHRDIKPLNTLLCEKGL--KLKICDFGTVV
Takl1_Dmel       EYTVEQAVRWALQCAKALAYLHSL-D-RPIVHRDIKPQNMLLYNQHE--DLKICDFGLAT
Tak1_Dmel        AYSLAHAMSWARQCAEGLAYLHAM-TPKPLIHRDVKPLNLLLTNKGR--NLKICDFGTVA
mom-4_Cele       NYTIDHVASWMFQLSSAVDFFHS----NSQVHRDLKLQNMLLSDRYR--TMKLCDFGTFT
TAK1_Mmus        YYTAAHAMSWCLQCSQGVAYLHSM-QPKALIHRDLKPPNLLLVAGGT--VLKICDFGTAC
Y105C5A.24_Cele  EYKMDHVASWMYQLSSAVNFFHS----KDQIHRDLKLQNMLLSHHHR--TLKICDFGTFT
TAK1_Spur        IYKAAHAMSWALQCAKGVDYLHSM-KPKKLIHRDLKPANLLLMSGGT--VLKICDFGTAC
AqueK667_Aque    TYEYNHVMHWARQTAVGLEYLHS----KGFLCPGIKPSNWHYYDASD-------------
AqueK668_Aque    DYNFNHFMSWTLQLALALECCHH----NSIIHRDINPTNLLLFDDGR--HLKICDFVTAK
AqueK669_Aque    TYEYDHVMHWARQIAVGLEYLHS----VRIIYRGVEPSNLLLFGNGS--LLKLCDFSHIP
AqueK670_Aque    IFSVDVIAQLLADITRGLQYLHSI----NILHRDLKSKNVLLTNPPPLCKAKLCDFGLAR
AqueK671_Aque    HLDWKLRLEIASQVADALNFLHRVNEPQSLIHGDVKSSNILL-DRHL--TPKLSDFGLAR
AqueK672_Aque    TYKNDHVMHWARQTALGLEYIHS----KRILYRDVKSSNLLLFGNGS--HLKLCDFGISC
AqueK673_Aque    DYNFNHFMSWTLQLALALECCHH----NSIIHRDIKPPNMLLFDDGR--CLKICDFGTAK
AqueK674_Aque    RYGVDHVMHWSRQTAVGLKHIHS----KRILHRDIKSSNLLLFGNGS--RLKLCDFGTCR
                             : : .:   *        :  .::  *

TAK1_Hsap        DI--QTH----------MTNNKGSAAWMAPEVF----------------------EGS--
Takl2_Dmel       DL--SQS----------ISCNAGTCRYKAPEVRELFDFKSNRIIINQPTGFQKVLQGN--
Takl1_Dmel       DM--SNN----------KTDMQGTLRYMAPEAI----------------------KHL--
Tak1_Dmel        DK--STM----------MTNNRGSAAWMAPEVF----------------------EGS--
mom-4_Cele       SM--HQS----------MTSNRGTPITMAPEVF----------------------RCE--
TAK1_Mmus        DI--QTH----------MTNNKGSAAWMAPEVF----------------------EGS--
Y105C5A.24_Cele  SI--HQS----------MTSNRGSPITMAPEIF----------------------RCE--
TAK1_Spur        DF--QTY----------MTNNKGSAAWMAPEVF----------------------EGR--
AqueK667_Aque    ----------------AI--HNDPVRYTAPEVL----------------------RGT--
AqueK668_Aque    LL--DDA--------AFTDTFIGTPYYLAPEVV----------------------EGA--
AqueK669_Aque    D---------------AL--LCGPVRYIAPEVF----------------------LDVNS
AqueK670_Aque    MRLESAT----------MTGNVGTVHWTAPEVL----------------------NCG--
AqueK671_Aque    ES--LNRPTHVTTVSANSRVAMGTVAYMAPEFL----------------------RNS--
AqueK672_Aque    NI--ETD--------ATYTSGVGTPRYMAPEVI----------------------KGT--
AqueK673_Aque    LL--DA---------TSADTFIGTPYYLAPEVI----------------------EGK--
AqueK674_Aque    NL--ETN--------LLYTASIGTVRYMAPEVI----------------------KGD--
                                       ..    ***

TAK1_Hsap        -NYS-EKCDVFSWGIILWEVITRRKPFDE---IGG----PAFRIMWAVHN-GTRPPLI--
Takl2_Dmel       -KPD-EKCDVYSWAITFWEILSRKEPFEQ---YNT-----LFELYMAINE-GKR------
Takl1_Dmel       -KYT-AKCDVYSFGIMLWELMTRQLPYSH---LENP--NSQYAIMKAISS-GEKLPMEAV
Tak1_Dmel        -KYT-EKCDIFSWAIVLWEVLSRKQPFKG---IDN-----AYTIQWKIYK-GERPPLL--
mom-4_Cele       -QYN-MKSDIYSIGIIMWQIIARNHPYRR--DLS------VPGLLYNVATANLRPQ-E--
TAK1_Mmus        -NYS-EKCDVFSWGIILWEVITRRKPFDE---IGG----PAFRIMWAVHN-GTRPPLI--
Y105C5A.24_Cele  -PYN-MKADIFSIGIIMWQMIARDHPYTM--NMP------ITPFLYNVATRNLRPH-E--
TAK1_Spur        -TYS-EKCDIFSWGVILWEVISRRKPFDD---IGG----PAFRIMWAVHN-GRRPPLI--
AqueK667_Aque    -SYSTEKRDIFNFAITLWEMLARQEPVVT--E-DDT--ETIFEGLNQMAN-GRRPPLL--
AqueK668_Aque    -----------------------------------------------------RMPTI--
AqueK669_Aque    ISYPLEKRDIFDFAITLWEMLARQEPVVT--G-DDT--KTIFEMLNQMANA---------
AqueK670_Aque    -RYH-FSADVYSFGMVLYEMVTRSIPFSH---LPPP--AV---IVAVLIR-RERPSLS--
AqueK671_Aque    -KPS-SKTDVYAFGVVILELFTGQAADDPSRDIRTLHDSNMKLIFAKIVT-IELPPLV--
AqueK672_Aque    -TYD-TKCDIFSFAITLWEMLARQIPTIE--GLDDN--SNIYAVFYAMAQLEKRPPLL--
AqueK673_Aque    --HS-NKCDVYSFAVTLWEMITRHKPTLD---LNQEGQPHPYNVFRTIGK-GARMPTI--
AqueK674_Aque    -PYT-TKCDIFSFAITLWEMLARQVPTIE--SV--S--ANSYAILYQMVQ-GKRPPLL--


TAK1_Hsap        -KNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYF--------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       RSDCPEGIKQLMECCMDINPEKRPSMKEIEKFLGEQYES---------------------
Tak1_Dmel        -TTCPKRIEDLMTACWKTVPEDRPSMQYIVGVMHEIVKDY--------------------
mom-4_Cele       -LECNPILSEFYKKCWNDNADIRPTSSECVEYFTLLKDEY--------------------
TAK1_Mmus        -KNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYF--------------------
Y105C5A.24_Cele  -IECNPILSNFYKRCWSDNPASRPTSADCVEYFRCLRSEY--------------------
TAK1_Spur        -RNIPKPLDKLMTS--DSSPVHSSTKDQQ-K-----------------------------
AqueK667_Aque    -VGHPSFVNELLQKCWNQDPGVRLTSTELVEKFKKICEHF--------------------
AqueK668_Aque    -IGIPKFLWELVTKCWAQQPVDRLSFAEIVRKLKRVPYKF--------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    -SDCHQTFRTLFEKCTSWDPVDRPSLLSILRDLMLLLPSLSLPGTSGPEDETVFDHTDSL
AqueK671_Aque    -FACIL------------------------------------------------------
AqueK672_Aque    -VGHPSFVNELLQKCWDQDPRLRPTSTELAEELGKICKNF--------------------
AqueK673_Aque    -IGIPKFLWELVTKCWAQQPVDRLSFDEIVRKLKGVPYKF--------------------
AqueK674_Aque    -VGHPPFVNELLEKCWDQDPAVRLTSNDLVDKFNKICEHF--------------------


TAK1_Hsap        -------PGADEPLQYPCQY--------SDEGQ---------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       --------GTDEDFIKPLD-----------------------------------------
Tak1_Dmel        -------TGADKALEYTFVN--QQIVTKESDGTVAA------------------------
mom-4_Cele       -------PNGSVPLSDSSTN----------------------------------------
TAK1_Mmus        -------PGADEPLQYPCQY--------SDEGQ---------------------------
Y105C5A.24_Cele  -------PNGNVPLWDPASG----------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    -------KFG-EPISLEYESAVGKW---MEEGSVDLTVTRVNMLGAPGAGKTCSQLLLLN
AqueK668_Aque    -------K-N-EPLSSRIE----NW---LKEGEVELKVTRINMHGAPGAGKTCSQRLLLN
AqueK669_Aque    ---------------------VGKW---MEEGSVDLTVTRVNMLGAPGAGKTCSQLLLLN
AqueK670_Aque    GHVMIDFDENDEQDEELMK-----F---LQEQ----------------------------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    -------KFG-EPIFCYDEIALEKW---MEEGSVDLTVTRVNMLGAPGAGKTCSQLLLLN
AqueK673_Aque    -------K-N-EPLLTRRR-----------------------------------------
AqueK674_Aque    -------TFG-EPLTVQEDSDD--------ED----------------------------


TAK1_Hsap        -SNS-----------------------------------------ATSTGSFMDIAS---
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       --ED-----------------------------------------TVAVVTY--------
Tak1_Dmel        QPDSLSSQEGELSPSSTQ---LTPTTAANANVNAIAIS-------KTTTSSMTENTS---
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        -SNS-----------------------------------------ATSTGSFMDIAS---
Y105C5A.24_Cele  -------------------------------A----------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    E----------DPPTNDT---STPIACPAVRATRVAVSDKM-IWNRVTRANLLDELAT--
AqueK668_Aque    E----------PPPPWDKLTDSTSVACPAVQATRISIDDKNRKWEKVDIEDLLHQLASTE
AqueK669_Aque    E----------DPPTNDT---STPIACPAVRATKVAVSDKL-VWNRVTRANLLDELAT--
AqueK670_Aque    -MES-----------------------------------------SVDGDSTLEVSS---
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    E----------DPPTNDT---STPIACPAVRATRVAVSDKM-IWSRVTRANLLDELAT--
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        --------TNTSNKSDTNMEQVPA---------TNDTIK----RLESKLLKNQ-------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ---------------------------------------------------HVDSSG---
Tak1_Dmel        --------STSSDITPTNSGQLDNNPLFYMVTNRWDAIP----EEESNESRNDSFNLTSS
mom-4_Cele       -----------------GPAETPP---------PH-------------------------
TAK1_Mmus        --------TNTSNKSDTNMEQVPA---------TNDTIK----RLESKLLKNQ-------
Y105C5A.24_Cele  ----------------SNTVKIPK----------S-------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ---------NLTTITAHSEQE--K---------TK-------------------------
AqueK668_Aque    VDEVPRSEDDISDSSDELSEEKPA---------TN-------------------------
AqueK669_Aque    ---------DLTTLTADLKQE--K---------TK-------------------------
AqueK670_Aque    --------NNVENVF-EDMRGVLS---------QH-ELKEYHSYTEEELVSSVSSVSSYR
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    ---------DLKTATDSEQEEVPL---------TA-------------------------
AqueK673_Aque    --------------SKTEVEKPPP---------SS-------------------------
AqueK674_Aque    ---------DDEDEEDEDESE--V---------TE-------------------------


TAK1_Hsap        --AKQQ---SESGRLSLGASRGSSVE----SLPPTS--EGKRM-----------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ----------------------------------------------------------SR
Tak1_Dmel        AEATQR---LETIRNGMILMACKPME----QLTLDV--EA--N-----------------
mom-4_Cele       ----AH---RPTM---LGTSSGSGIG--SNNRTPTA------------------------
TAK1_Mmus        --AKQQ---SESGRLSLGASRGSSVE----SLPPTS--EGKRM-----------------
Y105C5A.24_Cele  ----QP---GGRSPLPLPKT---EI---TPDVKPKE------------------------
TAK1_Spur        -----------------------------------------RH-----------------
AqueK667_Aque    ----QP---PAPAVLSLPDNTESSAE-VSSDLSPTPHDPTPAV-----------------
AqueK668_Aque    ----EP---PKKPTKNKRSESESSET-EPTENEPTKNEPTKKK-----------------
AqueK669_Aque    ----EP---PVPAVLSLPDNTVSSAE-VSSDLSPTPHVASPAV-----------------
AqueK670_Aque    VPHLVP-------ANSL-RGSAEEVA-R-VPSPPEAQE-GS-LRDDIYDTESSDRQLAER
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    ----TATFYSQSWTVTYTNPMESGNV-EIPS--HAPNEPIPAV-----------------
AqueK673_Aque    ---------------------DIHQIRRPDSHPPNQ-----M------------------
AqueK674_Aque    ----V--------------------------PPPSPPLALQRT-----------------


TAK1_Hsap        ------------SA---DMSEIEAR-------IAATTAYS-KP-----K-RGHRKTASFG
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       IMR---------------------------------------V-----------------
Tak1_Dmel        ------------GF---DLSPSESS-------SSSTNAKS--------------------
mom-4_Cele       ----------------------------------SKLLNPQQP-----G-QGHRRNRSET
TAK1_Mmus        ------------SA---DMSEIEAR-------IVATAAYS-KP-----K-RGHRKTASFG
Y105C5A.24_Cele  ----------------------------------------VAP-----A-KVQETPAL--
TAK1_Spur        ------------SV---DLLDLR-------------------------------------
AqueK667_Aque    ------------SS---GTEDIKEDKKYHTEAVVQEILAT-QP-------KGIRKSDHWL
AqueK668_Aque    ---------LVQKI---STENISTENKLTNTEVGERILHA-FK-----TGKSKKLNANWV
AqueK669_Aque    ------------SS---DMKNIKEDKKYHTEAVVQEILAT-QP-------KGIHISDHWL
AqueK670_Aque    IQREERKSILA--QDYRLASELQSR-------ERFSSNY-QRPPPPPPT-----------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    ------------L-------PLLQDKKYDTKAVVLEILAT-QP-------KEIRKSDHWL
AqueK673_Aque    ------------------------------------VVAF-DP-----DS--FEVVD---
AqueK674_Aque    ------------QS---DMSYVKSKMAA----MSTTGSTS-DP-------PGDANNDDTG


TAK1_Hsap        --NILDVPEIVISGNGQPRRRS--IQDLTVT-----------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        --------------------DG--RERLTVT-----------------------------
mom-4_Cele       FVVQPDLPYPTVPGEAGASRI---------------------------------------
TAK1_Mmus        --NILDVPEIVISGNGQPRRRS--IQDLTVT-----------------------------
Y105C5A.24_Cele  LPDTLKVPKV--------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    --N-------A--------------------------RA---------------------
AqueK668_Aque    --Y-------FIDSGGQPAYRE--LLPLFTKAAALNIITIDLTKGLDEKSNFQYRISQNM
AqueK669_Aque    --Y-------VIDSGGQPAYQE--LLPLFTRAASLNIITLDLSKPFNERFDLMYRIDGQY
AqueK670_Aque    -------------------PPYLPLKTLPTK-----------------------------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    --Y-------VIDSGGQPAYQE--LLPLFTRAASLNIVTLDLSKPFNERFDLMYRIDGKY
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    --NGTTVQS-QLSEPYEPTSPS--VEEGFQH-----------------------------


TAK1_Hsap        -----------------------GTEPGQVSSRSSSPSVRM-ITTSGPTSEKPTRS----
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        -----------------------DTKPVMMTTDLSNNNGGIHAHSNGLLSH----A----
mom-4_Cele       --------------------------P-----KSQSEAKNF-RDRAKSEQRQPHRDA---
TAK1_Mmus        -----------------------GTEPGQVSSRSSSPSVRM-ITTSGPTSEKPARS----
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ------------------------------------------------------------
AqueK668_Aque    FPIKTKLHYSNRSIIRSTISSEAMVNPIKFPYVSDMPKHHH-YLILGTRKELVTEEKLKE
AqueK669_Aque    FPCHSK--STQLAFFQSAVSTGASFKPLDISCISKKPTHSM-HLVLGTHYDKVSDATLKD
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    FPCHSK--STQLAFFQSAVSTGASFEPLDISCISKKPTHSM-HLVLGTHYDKVSDATLKE
AqueK673_Aque    ----------------NFEST--------------------------------S------
AqueK674_Aque    -----------------------GYPPRE-------------------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ------------------------------------------------------------
AqueK668_Aque    MNESLINSSNLSL----KSVIWNTPQESIIFPVNTMLPAGSKEREDASMEICTE--L--S
AqueK669_Aque    R-----------------------------------------------------------
AqueK670_Aque    ------------------------------------------DRKRF---VLSEVRR--K
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    KEEILM-SSMSSLESYLQNCVISQSDDSIIFPVNAI--AASEERAKYSEEICKA--IWYR
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ---------------------------SYI------------------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ------------------------------------------------------------
AqueK668_Aque    NCRVEMTIKLPIRLFTFEISLQLEAERKK------------------------RSFLTKT
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    GHKADLKHVQPVEKRAFKVGRVI-----ESESPNVDEGPKTVWTLQKEIASFST------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    GSDASLKIKIPIRWFVFELSLP------E------------------------QSIVSVK
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    -----------------------------------------L------------------
AqueK668_Aque    EVIKIGKSLRLDEESDIITALQYLHNVTIILYYGDVLENLIFINPKPILDVLSRLIAITY
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ----------------------------------SWLNKIKFREPKPTV-----------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    EALSIGKGCSME-KEDTKQALKYFHDVSLMLYYPEVI-NVIFIDSKPILEILSQLLALTY
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        -----------HPWTP-------------------------------D-----D-STDTN
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        -----------NGWQA----------RDEELQEQEHEQEIVNSLDVDV-----D-PDEDE
mom-4_Cele       -----------RPPP-------------------------------PF-----EHRRDSN
TAK1_Mmus        -----------HPWTP-------------------------------D-----D-STDTN
Y105C5A.24_Cele  ------------------------------------------------------ERQISN
TAK1_Spur        -----------------------------------------------V-----D-NDNSA
AqueK667_Aque    ---------ILIKPLA----------Q---------------------------------
AqueK668_Aque    VSQAKIQSIADPPPSP----------G---------------------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ---------------PVGRVVTNVRKMVNR-----------------INSKVFD-EIESF
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    VNKIDAIASISDKPLS----------P---------------------------------
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------S-----------------------------------------------


TAK1_Hsap        GSDN----------------SI---------------------------PMAYLTLDHQL
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       --DFWRHQLPSIRMTFP------------------------------------------I
Tak1_Dmel        NDGT----------------EQ---------------------------SLA-EILDPEL
mom-4_Cele       DEEK----------------HA---------------------------VFMNICSNEET
TAK1_Mmus        GSDN----------------SI---------------------------PMAYLTLDHQL
Y105C5A.24_Cele  EEEK----------------QK---------------------------IFMTALSNEDT
TAK1_Spur        NDDS----------------DV---------------------------SMAYSTLEPHL
AqueK667_Aque    -TVM----------------KNLKEGFFNEDIFEHLKSKSVVFSLPEFQLSDLIKLLLHL
AqueK668_Aque    -EKN----------------SLVKLGLFKEELLAIIGK--QIFN-NDFQPSHMITLLKHL
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    STDALTHVVPKVKTILPTKED----------------------------IQ-AEKLSSPV
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    -KIT----------------KNLKEGFFNEDIFEHLKSRAEVFSLPEFQLSDLIRLLLHL
AqueK673_Aque    -DDT----------------LV------------------------------------SI
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        QPLAPCPNSKESMAVFEQHCKMAQE-Y---------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       VKREA-------------------------------------------------------
Tak1_Dmel        QPEPPIPNDAESQLIYRDHRHMAKE-Y---------------------------------
mom-4_Cele       RPIDPDTRDEKSLEIFHQHCDNNKQ-Y---------------------------------
TAK1_Mmus        QPLAPCPNSKESMAVFEQHCKMAQE-Y---------------------------------
Y105C5A.24_Cele  RPIDPNEGDESSLELYHQHCLVNLN-Y---------------------------------
TAK1_Spur        QPLPPNPNSRESQDIFDEHMRMAQE-F---------------------------------
AqueK667_Aque    NIITKLEDEQKGHYFIPYALPSYNEPVS---VEETNAKPLLI------------------
AqueK668_Aque    HIIAEVENKEEGHYFFPCSLPSCDK-IE---EPSTKIQPLLI------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    APPPPAPPPPDN-------------------IPMKSKAPKQVIKTRVIGPAASNKTKMKS
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    NIITKLEDEPKGHYFIPYALPSYNEPVS---IKETNAKPLLI------------------
AqueK673_Aque    EPKQANPSSQYYIDGLDPDRQYVEQ-R---------------------------------
AqueK674_Aque    ----------------PVKRTSYPEGFSSFPVVKEPSGPVVV------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    --VWREEKS-EEILPVPTGLFPLTIVHLLNQKECVTKIS---PSTSEYYKFRDAISLKIT
AqueK668_Aque    --AWQIGNSGTKTLAIPQGLFPLTIVHLLEQRDYV-DFT---PVGKSYYRYYDAMSLHVY
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    PTKKS-------------------IVPPMPSQETT-SIKGSTK--------YS-------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    --VWREEES-EEILPVPTGLFPLTIVHLLNQKDYVTKIS---PSTSEYYKFRDAISLRIT
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    --VDH-------------------EVHEMDNHETT-GYT-----------SLDE------


TAK1_Hsap        -------------------------------MKV------QTE-IALLLQRKQELVA---
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ----------------------------------ERLGKTVVREMAK---AAADGDR---
Tak1_Dmel        -------------------------------LSV------DTN-LYYAQDFKDKLIV---
mom-4_Cele       -------------------------------ADA------WVI-KKEVMRAKHELIA---
TAK1_Mmus        -------------------------------MKV------QTE-IALLLQRKQELVA---
Y105C5A.24_Cele  -------------------------------AEV------LLA-KKEAINEKHKLVQ---
TAK1_Spur        -------------------------------LRV------QTE-LALLHTRKRALWS---
AqueK667_Aque    FT-QKHTLHLINRYTHIEVYFTGPTQHCPLVRKL------LTTAIDDSSD-AMHLKHNYV
AqueK668_Aque    IEKKKYTIDIVNCYTHIKICFYDCKKACPQIRKL------VIEAIKRSSK-NLDVDDNHI
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    -KGPHMKLPAVKQYYHSE---------------GSAAAKSIVQA-----------VT---
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    FT-QKHTLHLINRYTHIEVYFTGPTQHCPLVRKL------LTTAIDNSSD-AMHLKHNYV
AqueK673_Aque    -------------------------------FKI------LYE-MGQLDQKRIELDN---
AqueK674_Aque    ---NRLRFDIQRQYLHIEQA----------------------------------------


TAK1_Hsap        ----------------------------------EL------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ----------------------------------EV------------------------
Tak1_Dmel        ----------------------------------QM------------------------
mom-4_Cele       ----------------------------------QW------------------------
TAK1_Mmus        ----------------------------------EL------------------------
Y105C5A.24_Cele  ----------------------------------KW------------------------
TAK1_Spur        ----------------------------------FT------------------------
AqueK667_Aque    NAFACPSKRNSCYCIVGFSKDVHFINCTVCCESA---TISNDH-WAWFE-----------
AqueK668_Aque    FAFKCAAD-EQCYCIVK--EDYSSTICTHCRSPCEVLESDDDSCRCWFS-----------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ----------------------------------KG------------------------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    NAFACPVKRNSCYCIVGFSKDGHFINCTMCSEPA---TISDDH-WNWYNIEGSIVSNKQE
AqueK673_Aque    ----------------------------------EL------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ------------------------------------------------------------
AqueK668_Aque    ------------------------------------------------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    NFLLIILDKKPQLDDLHRLFQSSDFQFLIIGTALGVQVNDLQHSPMSASDKLLLVFQRWI
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ------------------------------------------------------------
AqueK668_Aque    ------------------------------------------------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    NSNMNITWRKALQVCEDYPDQFGLVKSDVIKFLSSDRAHDKYSDVIIYHLCIGPVESNNG
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ------------------------------------------------------------
AqueK668_Aque    ------------------------------------------------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    TQIKQDNDQSSDEISASGITDDNIYGGTYVDTMPATITPAVRRLMKEATELREPFPHYYT
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ------------------------------------------------------------
AqueK668_Aque    ------------------------------------------------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    QPMEDNLFEWHFTIQGPPGTDYEGGRYHGHIMISPEYPMKPPSVVFLTPNGRFKLNLEIC
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ------------------------------------------------------------
AqueK668_Aque    ------------------------------------------------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    MCGLETWQSYWGISTVLLELIDMMATDDDRSTFGSLDCTPEERRQLATRSLEWVCPSCGV
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ------------------------------------------------------------
AqueK668_Aque    ------------------------------------------------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    ANRTALPEGSEDIVSQMPKEEVNSQQPHDLDLQKEALLVAQFCPPSTDQSNQRNIDIKES
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ------------------------------------------------------------
AqueK668_Aque    ------------------------------------------------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    HDQSKDEGGTEINKESSTSGIRYRGQEETDQPLSASPPPPSFPANIFKMAAVSPPHTQWG
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ------------------------------------------------------------
AqueK668_Aque    ------------------------------------------------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    PGTTCIAKYNFLGSTPHDPNWFLARKVSDGQEGMVPFNYIKENIDEQEISSSSPVVETGS
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    -------------------------------NNNYPV-SL--------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ------------------------------------------------------------
AqueK668_Aque    ------------------------------------------------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    SQEQHKVKEAVELHAMPWFHGKMSRQEAENVLNPTKDGLFLVRESSFFAGDYILCVCYKG
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ------------------------------------------------------------
AqueK668_Aque    ------------------------------------------------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    KVGHCRITRTDKNLVTLNGKEYFENLISLVEHHQKDAGGLPCTLKYSAEKKWNIGISDFK
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ------------------------------------------------------------
AqueK668_Aque    ------------------------------------------------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    KHAVGKWMEEGSVDLTVTRVNMLGVPGAGKTCSLRLLLNEDPPTNDTSTPIACPAVRATR
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ------------------------------------------------------------
AqueK668_Aque    ------------------------------------------------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    VAVSDKMIWNRVTPAKLLDKLAANLAAVAVNLEQEKIEEPPSSVVLSFPDNAQSSGEVSS
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ------------------------------------------------------------
AqueK668_Aque    ------------------------------------------------------------
AqueK669_Aque    ------------------------------------------------------------
AqueK670_Aque    ------------------------------------------------------------
AqueK671_Aque    ------------------------------------------------------------
AqueK672_Aque    DPSSTSSKENSPQYHDEAFIQEILEILATQPKEIHISDHWLYVIDSGGQPAYQELLPLFT
AqueK673_Aque    ------------------------------------------------------------
AqueK674_Aque    ------------------------------------------------------------


TAK1_Hsap        ------------------------------------------------------------
Takl2_Dmel       ------------------------------------------------------------
Takl1_Dmel       ------------------------------------------------------------
Tak1_Dmel        ------------------------------------------------------------
mom-4_Cele       ------------------------------------------------------------
TAK1_Mmus        ------------------------------------------------------------
Y105C5A.24_Cele  ------------------------------------------------------------
TAK1_Spur        ------------------------------------------------------------
AqueK667_Aque    ----------