Protein (view, download) , Domain (view, download)
MST4_Hsap        MAHSPVAV----------------------------------------------------
MST3_Hsap        MDSRAQLWGLALNK----------------------------------------------
MST4_Mmus        MAHSPVAV----------------------------------------------------
MST3_Mmus        MESKVPRLGLALKR----------------------------------------------
gck-1_Cele       MTTTSSDE-LPRQA----------------------------------------------
SPS1_Scer        MESKEIS-----------------------------------------------------
KIC1_Scer        MTTKPQNS----------------------------------------------------
CG5169_Dmel      MSWT--------------------------------------------------------
YSK1_Mmus        MAHLRGF-----------------------------------------------------
YSK1_Hsap        MAHLRGF-----------------------------------------------------
SvkA_Ddis        MASK--------------------------------------------------------
17911_Tthe       ------------------------------------------------------------
YSK_Spur         MAM---------------------------------------------------------
CC1G_11537_Ccin  MSQ---------------------------------------------------------
CC1G_00304_Ccin  MTLTWSST-RSPPPSPKV------------------------------------------
CC1G_13722_Ccin  MDSR--------------------------------------------------------
AqueK239_Aque    MKRYSMKT-LQVAKGGGSIY-KHNIPYL-------------------------AGQTLE-
AqueK240_Aque    MATP--------------------------------------------------------
AqueK241_Aque    ------------------------------------------------------------
AqueK242_Aque    MATAKSGD-LCVGV----------------------------------------------
YSK_Smoe         MSNVGAAT-AAATAGTSS------------------------------------------
GK082_Glam       MEKKPVFL-LFGILRDQDLTLTTLLPFVICKTVYLCSDAEVVLFIWTTFGYFLGRFACHQ


MST4_Hsap        ------QVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAED
MST3_Hsap        RRATLPHPGGSTNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAED
MST4_Mmus        ------QVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAED
MST3_Mmus        RKATPLHPGGKENLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAED
gck-1_Cele       DDDSM-KWDRIYIQKLDPEVIFTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAED
SPS1_Scer        -----------IRSRTPPSKLYSIQSCIGRGNFGDVYKAVDRVTQEIVAIKVVNLEHSDE
KIC1_Scer        ------K-QGLAEGEMDVSSLFKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSD
CG5169_Dmel      -------------EKVDPELIFTKQERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAED
YSK1_Mmus        ---------AHQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAED
YSK1_Hsap        ---------ANQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAED
SvkA_Ddis        --------------KGDPEELYVRQEKIGKGSFGEVFKGINKKTNETIAIKTIDLEDAED
17911_Tthe       ------------------------------------------------------------
YSK_Spur         ------------------------------------------------------------
CC1G_11537_Ccin  ---------------PDVHQLYQRLETIGKGAYGSVHKGKHIPTGNVVALKIINLDTPDD
CC1G_00304_Ccin  EQRTRPRD-PCPIPSSNPASQYTLLEKLGTGSFGVVYKAIHNETKQIVAIKQIDLEDSDD
CC1G_13722_Ccin  --------------QQDPEEFYVKQDRIGKGSFGEVYKGYDKRTQKTVAIKIIDLESAED
AqueK239_Aque    TKDIPTLMATPLGKSGDPEVLFTRLKKIGKGSLGEVFKGIDIKSKEVLSFKIIELEEPEV
AqueK240_Aque    -----------LGKSADPEVLFTRLEKIGKGSFGEVFKGIDNQNKEVLAFKIIDLEEAED
AqueK241_Aque    ------------------------------------------------------------
AqueK242_Aque    GP----SSGSSGGGTTDPEGLFTKQEKIGSGNFGEVFKGVENRSNRVVAIKIIDLENADD
YSK_Smoe         SSSAAAAAAVAAAAAAGIDSRFDNLQLIGKGSFGDVFKGFDKELNKEVAIKVIDLEEAED
GK082_Glam       LRVFSLSNFTLLAKFVNNPMGYKLLKILGSGGFGSVYLALDEKTMTYVAIKTVDLEQSLS


MST4_Hsap        EIEDIQQEITVLSQC-DSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRA---G-PFD
MST3_Hsap        EIEDIQQEITVLSQC-DSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEP---G-PLD
MST4_Mmus        EIEDIQQEITVLSQC-DSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRA---G-PFD
MST3_Mmus        EIEDIQQEITVLSQC-DSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEP---G-PLD
gck-1_Cele       EIEDIQQEIQVLSQC-DSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTKS---G-KLD
SPS1_Scer        DIELLAQEIFFLAEL-KSPLITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVN-GLP
KIC1_Scer        EVEDVQREIQFLASLKQISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLRP---G-KID
CG5169_Dmel      EIDDIQQEIMVLSQC-DSPYVTKYYGSFLKGTKLWIIMEYLGGGSALDLMKA---G-SFE
YSK1_Mmus        EIEDIQQEITVLSQC-DSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKP---G-PLE
YSK1_Hsap        EIEDIQQEITVLSQC-DSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKP---G-PLE
SvkA_Ddis        EIEDIQQEINVLSQC-ESPFVTKYFGSFLKGSKLWIIMEYLAGGSVLDLMKP---G-PFD
17911_Tthe       -------------------------------------MEYCGGGSLAQLIKK--KG-QFQ
YSK_Spur         -----------------------TLGATMQGTKLWIIMEYLGGGSALDLLKS---G-AMD
CC1G_11537_Ccin  DVADIQREVALLTQLRDAPNITKYFGCYMDGPRVWIVMEYAQGGSVLTLMKASKDG-CIE
CC1G_00304_Ccin  DISEIQQEIASLAQC-DSEYVTKYYGSFVVHYKLWIVMEYLAGGSCLDLLKA---G-PFS
CC1G_13722_Ccin  EIEDIQQEIQILSQL-DSPHVTKYHGSYLKGSHLWIVMEYCSGGSCSDLMKP---G-VFR
AqueK239_Aque    EIDDIPREISVQPEC-DSPYIAKYYGSYVKETKLWIVMEYLGGGSALDLMQP---G-PVE
AqueK240_Aque    EIEDIQQEITILSQC-DSAHVTRYYGSYLxxxxxxxxxxxxxxxxxxxxxxx---x-xxx
AqueK241_Aque    ------------------------------------------------------------
AqueK242_Aque    EIEDVQQEITVLSQC-DSLYVTRYFGSYLKGTKLWIVMEYLGGGSARDLMQP---G-PLE
YSK_Smoe         EIDEIQKEISVLSQC-RSPYITEYYGSFLHGTKLWIVMEYMAGGSVSDLLET---GNPLD
GK082_Glam       ELDVVQKEVTLMTRL-MSNYTIRYYRSWCTESTLNIAMEA-GLCSVADILSI--VG-PLN


MST4_Hsap        EFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQG---------------------
MST3_Hsap        ETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHG---------------------
MST4_Mmus        EFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQG---------------------
MST3_Mmus        EIQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHG---------------------
gck-1_Cele       ESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHG---------------------
SPS1_Scer        EEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLNEEG---------------------
KIC1_Scer        EKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEG---------------------
CG5169_Dmel      EMHIGIILREVLKGLDYLHSERKLHRDIKAANVLLSEQG---------------------
YSK1_Mmus        ETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQG---------------------
YSK1_Hsap        ETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQG---------------------
SvkA_Ddis        EGYIAIILRELLKGLEYLHSEGKIHRDIKAANVLLSASG---------------------
17911_Tthe       EPYITIILKEILQALSYLHSNQMVHRDIKSANILIQKDG---------------------
YSK_Spur         EIYIATILREVIKGLDYLHCERKIHRDIKAANVLLSENG---------------------
CC1G_11537_Ccin  EKYTSVIIREVLVALSYLHKVPVIHRDLKAANILVTATG---------------------
CC1G_00304_Ccin  EAHIAVICRELLLGLDYLHAEGTIHRDIKAANVLLSSSG---------------------
CC1G_13722_Ccin  EEYIAIIIRELLRGLEYLHTEGKLHRDIKAANILLSANG---------------------
AqueK239_Aque    EVYIATILREVLHGLDYLHTQGKLHRDIKASNVLFSTTG---------------------
AqueK240_Aque    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx---------------------
AqueK241_Aque    ------------------------------------------------------------
AqueK242_Aque    ETQIATILREVLKGLEYLHTEKKLHRDIKAANILLSDRG---------------------
YSK_Smoe         ELSIACIIRDLLHALDYLHSEGKIHRDIKAANILLTANG---------------------
GK082_Glam       EATACFIMYHLVKGVAYLHESKVIHRDLKCANILVTDDSTSSTVAQQPDGLAKRLIDLIL


MST4_Hsap        --------------------------------------------DVKLADFGVAGQLTDT
MST3_Hsap        --------------------------------------------EVKLADFGVAGQLTDT
MST4_Mmus        --------------------------------------------DVKLADFGVAGQLTDT
MST3_Mmus        --------------------------------------------EVKLADFGVAGQLTDT
gck-1_Cele       --------------------------------------------DVKVADFGVAGQLTET
SPS1_Scer        --------------------------------------------MVKLGDFGVSGHIRST
KIC1_Scer        --------------------------------------------NVKLCDFGVAAQVNQT
CG5169_Dmel      --------------------------------------------DVKLADFGVAGQLTNT
YSK1_Mmus        --------------------------------------------DVKLADFGVAGQLTDT
YSK1_Hsap        --------------------------------------------DVKLADFGVAGQLTDT
SvkA_Ddis        --------------------------------------------DVKLADFGVSGQLTDQ
17911_Tthe       --------------------------------------------KVKLCDFGVSSKITNN
YSK_Spur         --------------------------------------------DVKLADFGVAGQLTET
CC1G_11537_Ccin  --------------------------------------------KVMICDFGVSALLTTV
CC1G_00304_Ccin  --------------------------------------------KVKLADFGVAAQLTNT
CC1G_13722_Ccin  --------------------------------------------EVKLADFGVSGQLSGT
AqueK239_Aque    --------------------------------------------QVKLTDFGVAGQLTDT
AqueK240_Aque    --------------------------------------------xxxxxxxxxxxxxxxx
AqueK241_Aque    ------------------------------------------------------------
AqueK242_Aque    --------------------------------------------EVKLADFGVAGQLTDT
YSK_Smoe         --------------------------------------------DVKVADFGVSAQLTRT
GK082_Glam       GKPVSPGLFSETSRPRSSHGSYISTIARSFSPRPNSDSAAALSLGIKLCDFGVSTTISST


MST4_Hsap        Q-IKRNTFVGTPFWMAPEVIQ--QS-AYDSKADIWSLGITAIELAKGEPPNSDMHPMRVL
MST3_Hsap        Q-IKRNTFVGTPFWMAPEVIK--QS-AYDSKADIWSLGITAIELARGEPPHSELHPMKVL
MST4_Mmus        Q-IKRNTFVGTPFWMAPEVIQ--QS-AYDSKADIWSLGITAIELAKGEPPNSDMHPMRVL
MST3_Mmus        Q-IKRNTFVGTPFWMAPEVIK--QS-AYDSKADIWSLGITAIELAKGEPPHSELHPMKVL
gck-1_Cele       V-KKRITFVGSPFWMAPELIK--QS-SYDYKADIWSLGITAIELANGEPPHSDLHPMRVL
SPS1_Scer        --LKRDTFVGTPYWMAPEVVCCEVD-GYNEKADIWSLGITTYELLKGLPPLSKYDPMKVM
KIC1_Scer        S-LRRQTMAGTPYWMAPEVIM--EGVYYDTKVDIWSLGITTYEIATGNPPYCDVEALRAM
CG5169_Dmel      T-SKRNTFVGTPFWMAPEVIK--QS-QYDAKADIWSLGITAIELAKGEPPNSELHPMRVL
YSK1_Mmus        Q-IKRNTFVGTPFWMAPEVIK--QS-AYDFKADIWSLGITAIELAKGEPPNSDLHPMRVL
YSK1_Hsap        Q-IKRNTFVGTPFWMAPEVIK--QS-AYDFKADIWSLGITAIELAKGEPPNSDLHPMRVL
SvkA_Ddis        M-TKRNTFVGTPFWMAPEVIK--QT-GYDSKADIWSMGITALEMAKGEPPRADLHPMRAL
17911_Tthe       S-QKLQTFVGTPYYMAPEVIQ--KS-EYDFKADIWSVGITAIEMATGHPPYYDKKPEIAM
YSK_Spur         Q-IKRNTFVGTPFWMAPEVIK--QS-AYDSKADMWSLGITAIELAKGEPPNSDLHPMRVL
CC1G_11537_Ccin  S-SKRTTLTGTPYWMAPEVIQ--GVSAYDTKADIWSLGIMIFEMIKGTPPHSNLDKFKVM
CC1G_00304_Ccin  L---RHTFVGTPFWMAPEVIR--QA-GYDSKADMWSLGITAIEMAKGEPPLAEYHPMRVL
CC1G_13722_Ccin  LSAKKNTFVGTPYWMSPEVIK--QS-GYDHKADIWSLGITAIELAKGEPPYAELHPMKVL
AqueK239_Aque    M-NKRNTIVERPFWMAPEVIT--RT-VYDTKADIWSLGITAIELAQGQPPHADLHPIRAL
AqueK240_Aque    x-xxxxxxxxxxxxxxxxxxx--xx-xxxxKADVWSLGITAIELAQGQPPHADLHPMRVL
AqueK241_Aque    -------------------------------ADVWSLGITAIELAQGQPPHADLHPMRVL
AqueK242_Aque    M--KKFTFVGTPFWMAPEVIR--QS-AYDMKADIWSLGITAIELARGEPPNSDLHPMRVL
YSK_Smoe         V-SKRKTFVGTPFWMAPEVIQ--NSDGYNEKADIWSLGITTIEMAKGEPPFADLHPMRVL
GK082_Glam       M-SKRCSFVGTPYWLSPEAIT--KN-ECDSFSDIWAVGICLYELIFGHPPHHKLSPTKAM
                                                 *:*::**   *:  * **  .     .:

MST4_Hsap        FLIPKNNPPTLVGD----FTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSK--KTS
MST3_Hsap        FLIPKNNPPTLEGN----YSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAK--KTS
MST4_Mmus        FLIPKNNPPTLIGD----FTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSK--KTS
MST3_Mmus        FLIPKNNPPTLEGN----YSKPLKEFVEACLNKEPSFRPTAKELLKHKFIIRNAK--KTS
gck-1_Cele       FLIPKNPPPVLQGS---QWSKPFKEFVEMCLNKDPENRPSASTLLKHQFI-KRAK--KNS
SPS1_Scer        TNLPKRKPPKLQGP----FSDAAKDFVAGCLVKTPADRPSAYNLLSFEFV-KNIT--ITN
KIC1_Scer        QLIIKSKPPRLEDR---SYSTSLKEFIALCLDEDPKERLSADDLLKSKFI-RAHKATPTS
CG5169_Dmel      FLIPKNNPPQLTGS----YTKSFKDFVEACLNKDPENRPTAKELLKYPFI-KKAK--KNA
YSK1_Mmus        FLIPKNNPPTLEGH----HSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTK--KTS
YSK1_Hsap        FLIPKNSPPTLEGQ----HSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTK--KTS
SvkA_Ddis        FLIPKDPPPTLEGN----FSKGFKEFCALCLNKDPNQRPTAKDLLKHKFI-KAAK--KTS
17911_Tthe       SRIVSEEPPSLSKE---TSSTMLINFVNCCLKYNPEQRQSAKQLLSHSFI-KLAK--KPS
YSK_Spur         FLIPKNNPPKLEGS----YTKNFKDFVEVCLNKDPRHRPTAKELLKHRFI-KQAK--RTS
CC1G_11537_Ccin  DLIPRAKPPRLQES---EGSKDMRDFMSYCLKESPTERLPAEELLKTKWI-KSISKVNVS
CC1G_00304_Ccin  FLIPKAKPPTLEGP----FSAAFKDFVTLCLTKDPKLRPSANELLQHRFI-RGAK--KTS
CC1G_13722_Ccin  FLIPKNPPPTLEGN----FSKTFREFVSYCLQRDPKERPSAKELLKHKFV-RMAK--KTS
AqueK239_Aque    FLIPKSNPPELLGN----YSESFKEFIAICLNKDPNNRPSARDLLHHKFM-KYAK--NTS
AqueK240_Aque    FLIPKSNPPELLGN----YSKSFKEFIALCLNKDPKNRPSARDLLRHKFI-KHAK--KTS
AqueK241_Aque    FLIPK---PELLGN----YSKSFKEFIALCLNKDPKNRPSARELLRHKFI-KHAK--KTS
AqueK242_Aque    FLIPKNSPPELTGN----FSKPFKEFVATCLNKDPSHRPTARELLKHRFL-KQAR--KTS
YSK_Smoe         FLIPKNNPPQLEDH----FSRPMKEFVSLCLKKNPAERASAKELLKHRFV-RNAR--KSP
GK082_Glam       IEIARNSSSTSLFDDKVEISKTCRDFAACCLDRDKTNRWPASKLLTHKWF-KTIQ--KVS
                   :     .          :    :*   **      * .*  **   :. :

MST4_Hsap        Y---LTELIDRFKRWKA---E-GHSDD---------------------------------
MST3_Hsap        Y---LTELIDRYKRWKA---E-QSHD----------------------------------
MST4_Mmus        Y---LTELIDRFKRWKA---E-GHSDE---------------------------------
MST3_Mmus        Y---LTELIDRYKRWKA---E-QSHE----------------------------------
gck-1_Cele       I---LVDLIERAAEYRL---R-TGVSS---------------------------------
SPS1_Scer        L-KSDVDLIKQ---KKV---Q-ERYTK---------------------------------
KIC1_Scer        I---LKELISRYLLFRD---K-NKN-----------------------------------
CG5169_Dmel      Y---LIDLIDRFKKWKV---S-KGDES---------------------------------
YSK1_Mmus        F---LTELIDRYKRWKS---E-GHGE----------------------------------
YSK1_Hsap        F---LTELIDRYKRWKS---E-GHGE----------------------------------
SvkA_Ddis        S---LTDLIERRQKWLQ---L-NGNNA---------------------------------
17911_Tthe       Y---LIDLFDIDLKRGNFLFKPGAPNQQIRANSMVTGSAILIPNNKPQGGKTADSELLIQ
YSK_Spur         Y---LTELIERYKRWKA---E-GNDSP---------------------------------
CC1G_11537_Ccin  I---LKDLILRLQQTGP---R-ASLAGP----------------L---------------
CC1G_00304_Ccin  Y---LTELIERYQEWRM---R-SPHKG---------------------------------
CC1G_13722_Ccin  Y---LTELIERHERWKA---E-GGDRG---------------------------------
AqueK239_Aque    C---LVDLIERYKRWKA---S-GENS----------------------------------
AqueK240_Aque    C---LVDLIDRYKRWKA---S-GENS----------------------------------
AqueK241_Aque    C---LVDLIDRYKRWKA---S-GENS----------------------------------
AqueK242_Aque    Y---LVDLIDRYKRWKA---N-GGEDG---------------------------------
YSK_Smoe         R---LLERIRERPKVHI---R-KPRSE---------------------------------
GK082_Glam       ARDVLAPIMEKYFRDFN---R-REQDRL----------------HDPFAIQTKQDDL---
                         :

MST4_Hsap        --------------------------------E--SD-SEGSDSE---------------
MST3_Hsap        --------------------------------D--SS-SEDSDAE---------------
MST4_Mmus        --------------------------------E--SD-SEGSDSE---------------
MST3_Mmus        --------------------------------D--SS-SEDSDVE---------------
gck-1_Cele       --------------------------------D--SD-----------------------
SPS1_Scer        --------------------------------V--PKYPLQNRLY---------------
KIC1_Scer        ----------------------KYKIEGSIP-EN-EP-SKPSEAPK-PSQNGGGDEAQKS
CG5169_Dmel      --------------------------------E--TE-SENSDSD---------------
YSK1_Mmus        --------------------------------E--SS-SEDSDID---------------
YSK1_Hsap        --------------------------------E--SS-SEDSDID---------------
SvkA_Ddis        --------------------------------D--D---ENDDLD---------------
17911_Tthe       STMKQITMEQRLEEQKDLKEFSNYLNSGNNPIDDK------C------------------
YSK_Spur         --------------------------------D--SD-PEDNEFP---------------
CC1G_11537_Ccin  ----------------------DWELEEE-------------------------------
CC1G_00304_Ccin  --------------------------------Q--N--NAATIRN---------------
CC1G_13722_Ccin  --------------------------------M--E---EDDRPR---------------
AqueK239_Aque    --------------------------------D--SN-PEDTSIS---------------
AqueK240_Aque    --------------------------------D--SD-SEDTSRS---------------
AqueK241_Aque    --------------------------------D--SD-SEDTSRS---------------
AqueK242_Aque    --------------------------------T--PT-KRKSVQS---------------
YSK_Smoe         --------------------------------H--MY--EQDTVE---------------
GK082_Glam       ---------------G-----YIWLPEEQGSAEEEFV-PVKQAAASRARANAGSEINV-T


MST4_Hsap        ----------S--TSR---E-NN----------TH-PEWSFT-TVRKK------------
MST3_Hsap        ----------T--DGQ-ASG-GS----------DS-GDWIF--TIREK------------
MST4_Mmus        ----------S--SSR---E-SN----------PH-PEWSFT-TVRKK------------
MST3_Mmus        ----------T--DGQ-ASG-GS----------DS-GDWIF--TIREK------------
gck-1_Cele       ----------L--DED-SDG-GG----------GT-SKWDYP-TVRGPRVS-ADD-----
SPS1_Scer        --------------KN-SN-TVR----------GK-EFWNFE-STRLST-----------
KIC1_Scer        IASND-----N--EIK-RVNEGD----------VE-MKWDFD-SLSSSDYII--ENNINL
CG5169_Dmel      ----------S--DAK-QGG-SS----------QD-EPWIM--TVKGLHIN-SAP-----
YSK1_Mmus        ----------G--E---AED-GE----------QG-PIWTFPPTIRPS------------
YSK1_Hsap        ----------G--E---AED-GE----------QG-PIWTFPPTIRPS------------
SvkA_Ddis        ----------R--D---AKS-NE----------ED-FGWEFP-TIKQKSPV-A-------
17911_Tthe       -KNMDQIVIDI--Y-R-GDKHKQ----------DKEKKKQVQ-SNKQSNQPT--------
YSK_Spur         ----------N--ESL---Q-NN-----------L-PDFDYGNTIRG-------------
CC1G_11537_Ccin  -------------------ADQN----------AQ-QDWEFD-TVRFDRRPSLDEEDYNA
CC1G_00304_Ccin  ----------T--ATW-DM-NDT----------IR-SDWNFD-TVKSMGAMG-TF-----
CC1G_13722_Ccin  ----------G--DPD-AGANGD----------PD-DMWDFG-TVRHAGRT-L-G-----
AqueK239_Aque    ----------K--VHR-GDDD---------------------------------------
AqueK240_Aque    ----------K--VHR-GDDDTT----------DP-PDWKFD-TVRETSTSE-AP-----
AqueK241_Aque    ----------K--VHR-GDDEAT----------DP-PDWKFD-TVRETSASE-AP-----
AqueK242_Aque    ----------I--DSQ-EDNDSG----------LD-DIWDFS-VDSPSDKTGTIK-----
YSK_Smoe         ----------KPKGLKAAKD-GESHLLSLTKAMRN-ASWDFG-TGTIQGIS-Q-G-----
GK082_Glam       FSPEDPYLNQL--DHE-KIQPTK----------KQ-EDWSFS-SDTSENSPQ--------


MST4_Hsap        ------------------------------------------------------------
MST3_Hsap        ------------------------------------------------------------
MST4_Mmus        ------------------------------------------------------------
MST3_Mmus        ------------------------------------------------------------
gck-1_Cele       ---------------------------------------------------DGTVR----
SPS1_Scer        ------------------------------------------------------------
KIC1_Scer        DALAEDNNEWATAQHDLFNYAYPDEDSYYFDPTSHNTRPFVYQGTTIGKGYPGTIAQNST
CG5169_Dmel      ---------------------------------------------------RAGVNSFQL
YSK1_Mmus        ------------------------------------------------------------
YSK1_Hsap        ------------------------------------------------------------
SvkA_Ddis        ------------------------------------------------------------
17911_Tthe       ------------------------------------------------------------
YSK_Spur         ------------------------------------------------------------
CC1G_11537_Ccin  PSQ--ATPTD-------------------------------------S---FETVRVPAS
CC1G_00304_Ccin  ---------------------------------------------------RGSVK----
CC1G_13722_Ccin  ---------------------------------------------------RGSVR----
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    ------------------------------------------------------------
AqueK241_Aque    ------------------------------------------------------------
AqueK242_Aque    ---------------------------------------------------RGSTS----
YSK_Smoe         ---------------------------------------------------TGTVR----
GK082_Glam       ------------------------------------------------------------


MST4_Hsap        ------------------------------------------------------------
MST3_Hsap        ------------------------------------------------------------
MST4_Mmus        ------------------------------------------------------------
MST3_Mmus        ------------------------------------------------------------
gck-1_Cele       -Q-------------------------------------------R--------------
SPS1_Scer        ------------------------------------------------------------
KIC1_Scer        L---NAPVT---------NNYTNSK-----------YPSKMVAGTTNTSGTHTAGPMTSS
CG5169_Dmel      QE-------------------------------------------H--------------
YSK1_Mmus        ------------------------------------------------------------
YSK1_Hsap        ------------------------------------------------------------
SvkA_Ddis        ---------------------------------------VQEQQQT--------------
17911_Tthe       ------------------------------------------------------------
YSK_Spur         ------------------------------------------------------------
CC1G_11537_Ccin  A-----------------------------------------------------------
CC1G_00304_Ccin  -DL-GM------------------------------------------------------
CC1G_13722_Ccin  -VA-GPPLTWENDGRNRMDDYSESRYK--RSLNNSEDSYSSSITAK--------------
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    ------------------------------------------------------------
AqueK241_Aque    ------------------------------------------------------------
AqueK242_Aque    -S-------------------------------------------T--------------
YSK_Smoe         -SGLRTPFGFDDRVESFEGDMSPRISSRSHDWHRTSASSSTEQQAA--------------
GK082_Glam       ------------------------------------------------------------


MST4_Hsap        ------------------------------------------------------------
MST3_Hsap        ------------------------------------------------------------
MST4_Mmus        ------------------------------------------------------------
MST3_Mmus        ------------------------------------------------------------
gck-1_Cele       ----T-------------------------DRPR----AQVDR--RSPSGSPGGTIVRGS
SPS1_Scer        ------------------------------------------------------------
KIC1_Scer        KRLES-------------------------KAPKQLLEL---------------------
CG5169_Dmel      ----E-------------------------LTMQ-----KLMQTTHSPA---GGGGVQAS
YSK1_Mmus        ------------------------------------------------------------
YSK1_Hsap        ------------------------------------------------------------
SvkA_Ddis        ----P-------------------------QKPT--------------------------
17911_Tthe       ------------------QST---------------------------------------
YSK_Spur         ------------------------------------------------------------
CC1G_11537_Ccin  K-----------------------------TLPSSLRHL---------------------
CC1G_00304_Ccin  ----PTGMILEADESDDGETSIDTGAATKGSDPL----L---------------------
CC1G_13722_Ccin  ----N-------------------------ELP---------------------------
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    ---------------------------------R----L---------------------
AqueK241_Aque    ---------------------------------R----L---------------------
AqueK242_Aque    ----D-------------------------SSPS--------------------------
YSK_Smoe         ----A-------------------------QEP---------------------------
GK082_Glam       ------------------HSK---------------------------------------


MST4_Hsap        ------------------------------------------------------------
MST3_Hsap        ------------------------------------------------------------
MST4_Mmus        ------------------------------------------------------------
MST3_Mmus        ------------------------------------------------------------
gck-1_Cele       PQVAAVAEQLRNSSVGSSGYGS-GGNSASSQYATSSLPQSHT----A------------S
SPS1_Scer        ------------------------------------------------------------
KIC1_Scer        ------------------------------------------------------------
CG5169_Dmel      PAANALSSSVSAVAASASS-VSVITANEGV-SSASALPPQNSHVHNHNHNNINNNNIRNL
YSK1_Mmus        ------------------------------------------------------------
YSK1_Hsap        ------------------------------------------------------------
SvkA_Ddis        ------------------------------------------------------------
17911_Tthe       ------------------------------------------FF----------------
YSK_Spur         ------------------------------------------------------------
CC1G_11537_Ccin  ------------------------------------------------------------
CC1G_00304_Ccin  ------------------------------------------------------------
CC1G_13722_Ccin  ------------------------------------------------------------
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    ------------------------------------------------------------
AqueK241_Aque    ------------------------------------------------------------
AqueK242_Aque    ---------------------------------------S--------------------
YSK_Smoe         ------------------------------------------------------------
GK082_Glam       -------------------------------------------L----------------


MST4_Hsap        --------------P---------------------------------------------
MST3_Hsap        ------------------------------------------------------------
MST4_Mmus        --------------P---------------------------------------------
MST3_Mmus        ------------------------------------------------------------
gck-1_Cele       SG---GATTITLG-----------------------------------------------
SPS1_Scer        --------------TQISKEELSPI------------------------------TQDSP
KIC1_Scer        FEDNEI----------------------I-----T-A--------E-------NDVNTEA
CG5169_Dmel      SN-KHATTTMLNAAP---------------------------------------------
YSK1_Mmus        --------------P---------------------------------------------
YSK1_Hsap        --------------P---------------------------------------------
SvkA_Ddis        --------------V---------VSTPIKEQQQQ-Q--------Q-------PTPVTTP
17911_Tthe       -----------NKGS----------NQNIT-QQH-S---------DSDN-----------
YSK_Spur         --------------P---------------------------------------------
CC1G_11537_Ccin  FGDSA-----------------------------S-T--------E-------PEPFTVP
CC1G_00304_Ccin  SN-SQ-----------------------------AAH--------S-------TVMIKNP
CC1G_13722_Ccin  -----------------------------------------------------PLPSS--
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    FN-KE-----------------------------E-T--------S-------PVPVPVP
AqueK241_Aque    FN-KE-----------------------------E-T--------S-------PVPVPVP
AqueK242_Aque    ------------------------------------------------------------
YSK_Smoe         -------------------------ETSLDSQGEA-Y--------DPDEASESSSPIFDS
GK082_Glam       -----------TSPP----------PPHLE-QNV-GQLSATGEDINGQD-----------


MST4_Hsap        -----------------------------------------------------D------
MST3_Hsap        -----------------------------------------------------D------
MST4_Mmus        -----------------------------------------------------D------
MST3_Mmus        -----------------------------------------------------D------
gck-1_Cele       ------------------------------------------------------------
SPS1_Scer        -----------------------------------------------------TSSLNME
KIC1_Scer        --------PKISKSISS-------------LNAGNSSRDDFIPS----ISNE-V------
CG5169_Dmel      -----------------------------------------------------P------
YSK1_Mmus        ------------------------------------------------------------
YSK1_Hsap        ------------------------------------------------------------
SvkA_Ddis        --------QQPVTTTTTTP-----------------------------------------
17911_Tthe       ---I--------------------------------------------------------
YSK_Spur         -----------------------------------------------------Q------
CC1G_11537_Ccin  --------PPFTRPLTPPQSTTPVTNEWNTIHH-VPSADDFASSTSNTLRRADN------
CC1G_00304_Ccin  -----------------------------------------------------P------
CC1G_13722_Ccin  ---------------AKSSRF--------------------------------E------
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    --------T--------------------------------------------P------
AqueK241_Aque    --------T--------------------------------------------P------
AqueK242_Aque    ------------------------------------------------------------
YSK_Smoe         GTFVAREKSSESTSNSETPRY--------------------------------Q------
GK082_Glam       --VI---------------------------LPLQSVADGFTDSLQG-------------


MST4_Hsap        -PK--------------KVQ-NGA-E----Q-----------------------------
MST3_Hsap        -PK--------------NLE-NGA-L----Q-----------------------------
MST4_Mmus        -PK--------------KLQ-NGE-E----Q-----------------------------
MST3_Mmus        -PK--------------NLE-NGT-L----Q-----------------------------
gck-1_Cele       ------------------SP-NGS-P----T-----------------------------
SPS1_Scer        SPY--------------LLH-GQT-VTPITN-----------------------------
KIC1_Scer        -NG--------------NIN-NNK-M---RPHLPPLSSGNNYYSQSTPALPLLQTKFNKT
CG5169_Dmel      -PS--------------SVTSSSS-A----S-----------------------------
YSK1_Mmus        -HS--------------KLH-KGT-A----L-----------------------------
YSK1_Hsap        -HS--------------KLH-KGT-A----L-----------------------------
SvkA_Ddis        --TTET--------KVRSL-----------------------------------------
17911_Tthe       -------------------M-NYL-Q----T-----------------------------
YSK_Spur         -------------------------Y----I-----------------------------
CC1G_11537_Ccin  -PP--------------IAE-PGE-E----PQ-PIIS----------PDVP---------
CC1G_00304_Ccin  -PH--------------LAE-SDD-I----A-----------------------------
CC1G_13722_Ccin  -PDT-----------VRTVQ-HAP------A-----------------------------
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    -PA--------------PVS-NGP-I----------------------------------
AqueK241_Aque    -PA--------------PVS-NGP-I----------------------------------
AqueK242_Aque    ------------------SE-NAY-P----P-----------------------------
YSK_Smoe         -PQLERSESSLQEDSAKNLA-EAKAA----L-----------------------------
GK082_Glam       -------------------G-GCA-R----V-----------------------------


MST4_Hsap        ------------------------------------------------------------
MST3_Hsap        ----------------------PS------------------------------------
MST4_Mmus        ------------------------------------------------------------
MST3_Mmus        ----------------------LS------------------------------------
gck-1_Cele       ----------------------SS----------------------------LA---RT-
SPS1_Scer        ----------------------PSS--------------------------------SSF
KIC1_Scer        SKGPPTSGLT--TAPTSIEIEIPEELPNSALP----TPASADPV-LIPSTKARS---ST-
CG5169_Dmel      ----------------------EL-----------------------------Q---QK-
YSK1_Mmus        ----------------------HS------------------------------------
YSK1_Hsap        ----------------------HS------------------------------------
SvkA_Ddis        -----------------------------------------------------S---NS-
17911_Tthe       ----------------------DS----------------------------D---SSQ-
YSK_Spur         ----------------------PE------------------------------------
CC1G_11537_Ccin  ------SPLEASLAPQ------PIQIPEP--PREELQPAFIQPHLGLPAEDLPS---FT-
CC1G_00304_Ccin  ----------------------DD------DIPNGAPPAYSGSV-RSA-----RRASYA-
CC1G_13722_Ccin  ----------------------PS-----------------SAK-RA-------------
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    ---------------------------------------------NGLSTNLTS---ND-
AqueK241_Aque    ---------------------------------------------NGLSTNLTS---Nx-
AqueK242_Aque    ----------------------ST------------------------------------
YSK_Smoe         ----------------------QS-----------------GSR-KGMGREKQS---SS-
GK082_Glam       ----------------------ST----------------------------D---ESN-


MST4_Hsap        ------------------------------------------------------------
MST3_Hsap        ------------------------------------------------------------
MST4_Mmus        ------------------------------------------------------------
MST3_Mmus        ------------------------------------------------------------
gck-1_Cele       Q--S----------MVSP------------------------------------------
SPS1_Scer        R--K----------CTQPV------------------F----------------------
KIC1_Scer        V--TAGTPSSSSSIQYKSP------------------SNVPRRLTVSNNRPEHCPSTITN
CG5169_Dmel      R--S----------SSKP------------------------------------------
YSK1_Mmus        ------------------------------------------------------------
YSK1_Hsap        ------------------------------------------------------------
SvkA_Ddis        ---S----------QTTPV------------------K----------------------
17911_Tthe       E-Q---------------------------------------------------------
YSK_Spur         ------------------------------------------------------------
CC1G_11537_Ccin  L--SQQTPGRSTPSRLDPP------------------AR---------SKPATHQSTISL
CC1G_00304_Ccin  ERSS----------TDGPGTVLNEADLGTGVDTIRPVK----------------------
CC1G_13722_Ccin  ---V----------QRE-------------------------------------------
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    D-ER----------VSDPD------------------S----------------------
AqueK241_Aque    x-xx----------xxxxx------------------x----------------------
AqueK242_Aque    ------------------------------------------------------------
YSK_Smoe         K--R----------REDPV------------------V----------------------
GK082_Glam       E-P---------------------------------------------------------


MST4_Hsap        ------------------------------------------------------------
MST3_Hsap        ------------------------------------------------------------
MST4_Mmus        ------------------------------------------------------------
MST3_Mmus        ------------------------------------------------------------
gck-1_Cele       ------------------------------------------------------------
SPS1_Scer        ------------------------------------------------------------
KIC1_Scer        QKLGSAVASNSGISSTPNNSNNYNNNTDSENSRGSSGSNTANSTQMGITNPGNVTKLSTH
CG5169_Dmel      ------------------------------------------------------------
YSK1_Mmus        ------------------------------------------------------------
YSK1_Hsap        ------------------------------------------------------------
SvkA_Ddis        ------------------------------------------------------------
17911_Tthe       ------------------------------------------------------------
YSK_Spur         ------------------------------------------------------------
CC1G_11537_Ccin  DNTSAPGNGNLGVTY--SPSPIV-------------------------------------
CC1G_00304_Ccin  ------------------------------------------------------------
CC1G_13722_Ccin  ------------------------------------------------------------
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    ------------------------------------------------------------
AqueK241_Aque    ------------------------------------------------------------
AqueK242_Aque    ------------------------------------------------------------
YSK_Smoe         ------------------------------------------------------------
GK082_Glam       ------------------------------------------------------------


MST4_Hsap        ------------------------------------------------------------
MST3_Hsap        ------------------------------------------------------------
MST4_Mmus        ------------------------------------------------------------
MST3_Mmus        ------------------------------------------------------------
gck-1_Cele       ----------------------------------------------SGQRSGSAQSW---
SPS1_Scer        --------------------------EL--------------------------------
KIC1_Scer        KASSPSRPLFGVGTSPNRKPAGSPTQNIGHNSTHTN------------------------
CG5169_Dmel      ----------------------------------------------ELRQSRSAAPLDQV
YSK1_Mmus        ------------------------------------------------------------
YSK1_Hsap        ------------------------------------------------------------
SvkA_Ddis        --------------------------TTVAATTAPATTP--ASNAPT-------------
17911_Tthe       ---------------------------------------SCNTDHPS-------------
YSK_Spur         ------------------------------------------------------------
CC1G_11537_Ccin  --------------------------RTRSATTLPA------------------------
CC1G_00304_Ccin  --------------------------KVDAAGSL--------------------------
CC1G_13722_Ccin  -----------------------------PSDDYED-YDDQYEDYPA-------------
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    --------------------------RL--------------------------------
AqueK241_Aque    --------------------------xx--------------------------------
AqueK242_Aque    ------------------------------------------------------------
YSK_Smoe         --------------------------TTDPSTSADPGRKSSYLDVPK-------------
GK082_Glam       ----------------------------------------SPTIHPS-------------


MST4_Hsap        ------------------------------------------------------------
MST3_Hsap        ------------------------------------------------------------
MST4_Mmus        ------------------------------------------------------------
MST3_Mmus        ------------------------------------------------------------
gck-1_Cele       ------------------------------------------------------------
SPS1_Scer        ------------------------------------------------------------
KIC1_Scer        ------------------------------------------------------------
CG5169_Dmel      EDRRASLGLPLQSSVPTPSTAEQQQQRRSSQRESFHANNAALVASCSSSSNNHSHEEHVA
YSK1_Mmus        ------------------------------------------------------------
YSK1_Hsap        ------------------------------------------------------------
SvkA_Ddis        ------------------------------------------------------------
17911_Tthe       -----------------NH-----------------------------------------
YSK_Spur         ------------------------------------------------------------
CC1G_11537_Ccin  ------------------------------------------------------------
CC1G_00304_Ccin  ------------------------------------------------------------
CC1G_13722_Ccin  ------------------------------------------------------------
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    ------------------------------------------------------------
AqueK241_Aque    ------------------------------------------------------------
AqueK242_Aque    ------------------------------------------------------------
YSK_Smoe         ------------------------------------------------------------
GK082_Glam       -----------------EL-----------------------------------------


MST4_Hsap        -----D------------------------------------------------------
MST3_Hsap        -----D-------------------L--D-------RN----K-----------------
MST4_Mmus        -----D------------------------------------------------------
MST3_Mmus        -----D-------------------L--E-------RN----K-----------------
gck-1_Cele       -----E-------------------L--E-------R-----------------------
SPS1_Scer        -----D-------------------SGMD-------ID----SGCPNAQAETEIVPLSNH
KIC1_Scer        -----LAPP----------------P--TMKPMANSKDNKDIL-----------------
CG5169_Dmel      TNHASH-------------------V--K-------HS----G-----------------
YSK1_Mmus        ----------------------------S-------QK----P-----------------
YSK1_Hsap        ----------------------------S-------QK----P-----------------
SvkA_Ddis        -----S-------------------T--T-------PN----G-----------------
17911_Tthe       ----YI-------------------Q--K-------MN----K-----------------
YSK_Spur         -----P-------------------P--H-------PE----P-----------------
CC1G_11537_Ccin  -----IQPP----------------P----------------------------------
CC1G_00304_Ccin  -----R--LSTGYLGSIRKEGSGSSY-ST-------HK----R-----------------
CC1G_13722_Ccin  -----K-------------------MAAL-------QD----K-----------------
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    ----SD-------------------Q--S-------ME----G-----------------
AqueK241_Aque    ----xx-------------------x--x-------xx----x-----------------
AqueK242_Aque    ------------------------------------------------------------
YSK_Smoe         -----V-------------------R--L-------SS----G-----------------
GK082_Glam       ----VH-------------------K--D-------LS----N-----------------


MST4_Hsap        --------------LVQT--LSC-------------------------------------
MST3_Hsap        -----MK--DI--PKRPF--SQC-------------------------------------
MST4_Mmus        --------------LVQT--LSC-------------------------------------
MST3_Mmus        -----MK--DI--PKRPF--SQC-------------------------------------
gck-1_Cele       -------------GNRPM--SERVSSQV---------SPSKYN-QHRTSSSNGVQGGSGG
SPS1_Scer        NKKHKKN--DIQALKIEK--FDY-------------------------------------
KIC1_Scer        -----LQ--PL--NSIPS--SSTLNTISGNSSNNLTSSNYFSN-EKEG------------
CG5169_Dmel      -----AG---Q-RLVQTN--SAC-------------------------------------
YSK1_Mmus        -----AE--PI--KRQPR--SQC-------------------------------------
YSK1_Hsap        -----AE--PV--KRQPR--SQC-------------------------------------
SvkA_Ddis        -----AA--VT-QQQAPR--ASA-------------------------------------
17911_Tthe       -----CT------NEQEK--RKILEGAL---------DKVFEQ-----------------
YSK_Spur         -----VE--SI-PRRQPK--SEC-------------------------------------
CC1G_11537_Ccin  ----------V--SIIPRAFVQQSSPVKS-------------------------------
CC1G_00304_Ccin  -----SA--SE-G-ARAG--RAM-------------------------------------
CC1G_13722_Ccin  -----VDDLHI-EDDVPD--TTM-------------------------------------
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    -----VE--PV-RPVEPV--IPV-------------------------------------
AqueK241_Aque    -----xx--xx-xxxxxx--xxx-------------------------------------
AqueK242_Aque    --------------SEPI--STS-------------------------------------
YSK_Smoe         -----EEEHAR-TLITEG--SPA-------------------------------------
GK082_Glam       -----AT--PL--KDTVN--RPTTAVKL---------HSVLSQDPSQKTQIHIPGAQ---


MST4_Hsap        ------------------------------------------------------------
MST3_Hsap        ------------------------------------------------------------
MST4_Mmus        ------------------------------------------------------------
MST3_Mmus        ------------------------------------------------------------
gck-1_Cele       RREYINGSGSGL---------------------NGNSSNQNHSEYSDAVRQRGPGGSGGR
SPS1_Scer        ------------------------------------------------------------
KIC1_Scer        ------------------------------------------------------------
CG5169_Dmel      ------------------------------------------------------------
YSK1_Mmus        ------------------------------------------------------------
YSK1_Hsap        ------------------------------------------------------------
SvkA_Ddis        ------------------------------------------------------------
17911_Tthe       ------------------------------------------------------------
YSK_Spur         ------------------------------------------------------------
CC1G_11537_Ccin  ------------------------------------------------------------
CC1G_00304_Ccin  ------------------------------------------------------------
CC1G_13722_Ccin  ------------------------------------------------------------
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    ------------------------------------------------------------
AqueK241_Aque    ------------------------------------------------------------
AqueK242_Aque    ------------------------------------------------------------
YSK_Smoe         ------------------------------------------------------------
GK082_Glam       -----------ITDALKVPQVPQIPAIPPAPAFS-DSVSLSARHRTDKYSLTSPGPS-SR


MST4_Hsap        --------------------------------------------LS--------------
MST3_Hsap        --------------------------------------------LS--------------
MST4_Mmus        --------------------------------------------LS--------------
MST3_Mmus        --------------------------------------------LS--------------
gck-1_Cele       LDYRESHVPTSSQENLNHGRMYGYGAPPPSREANNVPMPRVKGALD--------------
SPS1_Scer        --------------------------------------------LK--------------
KIC1_Scer        ---------------------------------------------SRVNGDFKRNNPNLK
CG5169_Dmel      --------------------------------------------LN--------------
YSK1_Mmus        --------------------------------------------LS--------------
YSK1_Hsap        --------------------------------------------LS--------------
SvkA_Ddis        --------------------------------------------LT--------------
17911_Tthe       ------------------------------------------------------------
YSK_Spur         --------------------------------------------IQ--------------
CC1G_11537_Ccin  ------------------------------------------------------------
CC1G_00304_Ccin  --------------------------------------------VD--------------
CC1G_13722_Ccin  --------------------------------------------LD--------------
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    --------------------------------------------ID--------------
AqueK241_Aque    --------------------------------------------xx--------------
AqueK242_Aque    --------------------------------------------LS--------------
YSK_Smoe         --------------------------------------------LS--------------
GK082_Glam       SELRKLSFNSSD--------PPGYKTPPPPSFITSSKLEASK-TYS--------------


MST4_Hsap        ---MIITPAFA-----------------------------------------------EL
MST3_Hsap        ---TIISPLFA-----------------------------------------------EL
MST4_Mmus        ---MIITPAFA-----------------------------------------------EL
MST3_Mmus        ---TIISPLFA-----------------------------------------------EL
gck-1_Cele       ---CSLLPAIE-----------------------------------------------HL
SPS1_Scer        ---NIVSHILN-----------------------------------------------RM
KIC1_Scer        LQMPLPTPVVRNKLLDPNTATSQNNNGMPGSAGISTNENINQFGFNTSSASNIPVSMTPI
CG5169_Dmel      ---NFLFPVLS-----------------------------------------------DI
YSK1_Mmus        ---TLVRPVFG-----------------------------------------------EL
YSK1_Hsap        ---TLVRPVFG-----------------------------------------------EL
SvkA_Ddis        ---SVIYPVLS-----------------------------------------------KL
17911_Tthe       --------YIS-----------------------------------------------YS
YSK_Spur         ---SLLGPILR-----------------------------------------------DL
CC1G_11537_Ccin  -------AT--------------------------------------------------F
CC1G_00304_Ccin  ---EVVLPVLQ-----------------------------------------------RA
CC1G_13722_Ccin  ---SVVLPAIA-----------------------------------------------SL
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    ---RIIHPVMN-----------------------------------------------RL
AqueK241_Aque    ---xxxxxxxx-----------------------------------------------xL
AqueK242_Aque    ---KIIMPLLA-----------------------------------------------QF
YSK_Smoe         ---LLLIPALK-----------------------------------------------ET
GK082_Glam       ----TISATLS-----------------------------------------------RS


MST4_Hsap        K-----------QQDENNAS----------------------------------------
MST3_Hsap        K-----------EKSQACGG----------------------------------------
MST4_Mmus        K-----------QQDENNAS----------------------------------------
MST3_Mmus        K-----------EKSQACGG----------------------------------------
gck-1_Cele       S-----------------------------------------------------------
SPS1_Scer        Y-----------DRARDD------------------------------------------
KIC1_Scer        S-----------EKHIDFGGKIKRSQSISNRKNSSASEHPLNILGSSVSGNVSGIGNNNV
CG5169_Dmel      Q-----------RKYSGGGSAGS----------------------------------GGS
YSK1_Mmus        K-----------EKHKQSGG----------------------------------------
YSK1_Hsap        K-----------EKHKQSGG----------------------------------------
SvkA_Ddis        L-----------KNTSDE-N----------------------------------------
17911_Tthe       ------------KNSQNHEY----------------------------------------
YSK_Spur         K-----------RKNE---G----------------------------------------
CC1G_11537_Ccin  T-----------DDPSARGGP---------------------------------------
CC1G_00304_Ccin  I-----------RDDMDA------------------------------------------
CC1G_13722_Ccin  F-----------PRVSTQ-E----------------------------------------
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    K-----------SEAFEGGGSG------------------------------------NS
AqueK241_Aque    K-----------SEGFEGGGSG------------------------------------NS
AqueK242_Aque    D-----------APVDGNWRT---------------------------------------
YSK_Smoe         A-----------AEQSEG-S----------------------------------------
GK082_Glam       QKNSVDILIATLRTVAASH-----------------------------------------


MST4_Hsap        ------------------------------------------------------------
MST3_Hsap        ------------------------------------------------------------
MST4_Mmus        ------------------------------------------------------------
MST3_Mmus        ------------------------------------------------------------
gck-1_Cele       ------------------------------------------------------------
SPS1_Scer        ------------------------------------------------------------
KIC1_Scer        GSNNNSGPNNSVPLSANTGNTTIKANSTTIATSSSAAASTTAPISQQTIPSGTQFNHILS
CG5169_Dmel      G-----------------------------------------------------------
YSK1_Mmus        ------------------------------------------------------------
YSK1_Hsap        ------------------------------------------------------------
SvkA_Ddis        ------------------------------------------------------------
17911_Tthe       ------------------------------------------------------------
YSK_Spur         ------------------------------------------------------------
CC1G_11537_Ccin  ------------------------------------------------------------
CC1G_00304_Ccin  ------------------------------------------------------------
CC1G_13722_Ccin  ------------------------------------------------------------
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    P-------ER--------------------------------------------------
AqueK241_Aque    P-------ER--------------------------------------------------
AqueK242_Aque    ------------------------------------------------------------
YSK_Smoe         ------------------------------------------------------------
GK082_Glam       ------------------------------------------------------------


MST4_Hsap        --------------------------------------------RNQAIEELEKSIAVAE
MST3_Hsap        --------------------------------------------NLGSIEELRGAIYLAE
MST4_Mmus        --------------------------------------------RNQAIEELEKSIAVAE
MST3_Mmus        --------------------------------------------NLGSIEELRGAIYLAE
gck-1_Cele       ----------------------------------------RTRHATAALDQLRHVFRDVE
SPS1_Scer        -------------------------------------------ETRKYVNEMLKQFIKTE
KIC1_Scer        SAATAANSVNSLGFGMCPPPQSLQMEMFLDLESFLPGKQRRVDRKPQVLKELENLLQMFE
CG5169_Dmel      ---------------------------------------GRNIGVGSDIGDLKSVFELAE
YSK1_Mmus        --------------------------------------------SVGALEELENAFSLAE
YSK1_Hsap        --------------------------------------------SVGALEELENAFSLAE
SvkA_Ddis        --------------------------------------------VINALAQLKMAFDNAE
17911_Tthe       --------------------------------------------LTLALQQLHCAFDEME
YSK_Spur         --------------------------------------------LSGAIDELQNSFDMAE
CC1G_11537_Ccin  -----------------------------------------------GLKDVLKIPSLTT
CC1G_00304_Ccin  -------------------------------------------REIESLSMLQRGFEELK
CC1G_13722_Ccin  --------------------------------------------ARVALSALQRAFTEAE
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    ------------------------------------EVPSPDRRSNLAIEELERAFELLE
AqueK241_Aque    ------------------------------------EVSSPDRWSNLAIEELERAFELLE
AqueK242_Aque    ----------------------------------------SGQEAMVSIAELMAAFREVE
YSK_Smoe         --------------------------------------------ALRAAADAADALIDLE
GK082_Glam       --------------------------------------------QVESVEQLVSEFS---


MST4_Hsap        AACPGITDK---------------------------------------------------
MST3_Hsap        EACPGISDT---------------------------------------------------
MST4_Mmus        TACPGITDK---------------------------------------------------
MST3_Mmus        EACPGISDT---------------------------------------------------
gck-1_Cele       DSCPGICNE---------------------------------------------------
SPS1_Scer        ANVPGFNEV---------------------------------------------------
KIC1_Scer        EGLPCIEHA---------------------------------------------------
CG5169_Dmel      RSSPGVSDL---------------------------------------------------
YSK1_Mmus        ESCPGISDK---------------------------------------------------
YSK1_Hsap        ESCPGISDK---------------------------------------------------
SvkA_Ddis        KAKPGITHS---------------------------------------------------
17911_Tthe       REENGSSKK---------------------------------------------------
YSK_Spur         ESSPGICDR---------------------------------------------------
CC1G_11537_Ccin  ESHLGMVDLLPPSPSALVTSNRSPGAHGISKPSRSYGGPMDYPSPATSKFAMEQDRSQRS
CC1G_00304_Ccin  EANSELAYN---------------------------------------------------
CC1G_13722_Ccin  RIIPGVTHE---------------------------------------------------
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    SSNPGFSEI---------------------------------------------------
AqueK241_Aque    SSNPGFSEI---------------------------------------------------
AqueK242_Aque    ETRPGFCDE---------------------------------------------------
YSK_Smoe         RMAPGACEV---------------------------------------------------
GK082_Glam       ALGNDFCDS---------------------------------------------------


MST4_Hsap        --------------------------------------------------------MV--
MST3_Hsap        --------------------------------------------------------MV--
MST4_Mmus        --------------------------------------------------------MV--
MST3_Mmus        --------------------------------------------------------MV--
gck-1_Cele       --------------------------------------------------------LI--
SPS1_Scer        --------------------------------------------------------FI--
KIC1_Scer        --------------------------------------------------------LK--
CG5169_Dmel      --------------------------------------------------------FM--
YSK1_Mmus        --------------------------------------------------------LM--
YSK1_Hsap        --------------------------------------------------------LM--
SvkA_Ddis        --------------------------------------------------------LI--
17911_Tthe       --------------------------------------------------------IL--
YSK_Spur         --------------------------------------------------------LV--
CC1G_11537_Ccin  AQNSISVDGLPTLEPLNYAALISNGDPQNELMQTIEGLASWLKVVDQGFQAMLEHSAFGD
CC1G_00304_Ccin  --------------------------------------------------------VI--
CC1G_13722_Ccin  --------------------------------------------------------LV--
AqueK239_Aque    ------------------------------------------------------------
AqueK240_Aque    --------------------------------------------------------FI--
AqueK241_Aque    --------------------------------------------------------FI--
AqueK242_Aque    --------------------------------------------------------LV--
YSK_Smoe         --------------------------------------------------------LV--
GK082_Glam       --------------------------------------------------------FI--


MST4_Hsap        ------KKLIEKFQK-CSA-----------------------------------------
MST3_Hsap        ------AQLVQRLQR-YSLSG---------------------------------------
MST4_Mmus        ------KKLIEKFQK-CSA-----------------------------------------
MST3_Mmus        ------AQLVQRLQR-YSLSG---------------------------------------
gck-1_Cele       ------EELMQRIAV-PQVSQ---------------------------------------
SPS1_Scer        ------EEISLRIEA-I-------------------------------------------
KIC1_Scer        ------EQLIST------------------------------------------------
CG5169_Dmel      ------KELIHMLVPGYSETR---------------------------------------
YSK1_Mmus        ------V