Protein (view, download) , Domain (view, download)
GSK3B_Hsap       MSGRPRTT----------------------------------------------------
GSK3A_Hsap       MSGGGPSGGGP----------------G--------------------------------
Pk34A_Dmel       MENKEKKQKPLK------------------------------------------------
sgg_Dmel         MFTFYTNINNTLINNNNNNNNTSNSNNNNNNVISQPIKIPLTERFSSQTSTGSADSGVIV
gskt_Dmel        MASQSKNSG---------------------------------------------------
GSK3B_Mmus       MSGRPRTT----------------------------------------------------
GSK3A_Mmus       MSGGGPSGGGP----------------G--------------------------------
R03D7.5_Cele     MANFIRLAYN--------------------------------------------------
F21F3.2_Cele     MSVTVEQ-----------------------------------------------------
C44H4.6_Cele     MNRMRRSTAFS-------------------------------------------------
C36B1.10_Cele    MPNTYRTSDE--------------------------------------------------
RIM11_Scer       MNIQSNNSPNLS------------------------------------------------
MRK1_Scer        MTDVLRSLVRKI------------------------------------------------
MCK1_Scer        MSTEEQNG--V-------------------------------------------------
Y106G6D.4_Cele   MNEDENKGIV--------------------------------------------------
Y106G6E.1_Cele   MPNIYRTTDE--------------------------------------------------
Y18D10A.5_Cele   MNKQLLSC----------------------------------------------------
YOL128C_Scer     MLKVNNVFGSN-------------------------------------------------
GlkA_Ddis        MTIPTDNNSSNN------------------------------------------------
GSK-3_Ddis       MSSKDQILE-K-------------------------------------------------
19912_Tthe       MLSQTVPLSSVL------------------------------------------------
19923_Tthe       MGGNGSRMH---------------------------------------------------
19924_Tthe       MNMRIPTQNYD-------------------------------------------------
2636_Tthe        MIKREILIKSKI------------------------------------------------
5825_Tthe        MNVSQSQGNVMQ------------------------------------------------
7876_Tthe        MYNNMTSNKPN-------------------------------------------------
GSK3_Spur        MCTVERPASGEW---------------S--------------------------------
n1163_Tthe       MAEFQQETEQLK------------------------------------------------
CC1G_03802_Ccin  MATHGPING---------------------------------------------------
AqueK117_Aque    MSSTFNKKEPP-------------------------------------------------
GSK_b_Smoe       MESRVDSMQ-E-------------------------------------------------
GSK_a-2_Smoe     MASASVGPVGA-------------------------------------------------
GSK_a-1_Smoe     MASASVGPVGA-------------------------------------------------
GK035_Glam       MLPQKLPEL---------------------------------------------------
GK036_Glam       MSDDETAFPPE-------------------------------------------------
                 *

GSK3B_Hsap       ------------------------------------------------------------
GSK3A_Hsap       ----------GSGRARTS------------------------------------------
Pk34A_Dmel       ------------------------------------------------------------
sgg_Dmel         SSASQQQLQLPPPRSSSG------------------------------------------
gskt_Dmel        ------------------------------------------------------------
GSK3B_Mmus       ------------------------------------------------------------
GSK3A_Mmus       ----------GSGRARTS------------------------------------------
R03D7.5_Cele     ------------------------------------------------------------
F21F3.2_Cele     ------------------------------------------------------------
C44H4.6_Cele     ------------------------------------------------------------
C36B1.10_Cele    ------------------------------------------------------------
RIM11_Scer       ------------------------------------------------------------
MRK1_Scer        -------------SFNNS------------------------------------------
MCK1_Scer        ------------------------------------------------------------
Y106G6D.4_Cele   ------------------------------------------------------------
Y106G6E.1_Cele   ------------------------------------------------------------
Y18D10A.5_Cele   ------------------------------------------------------------
YOL128C_Scer     ------------------------------------------------------------
GlkA_Ddis        ------------------------------------------------------------
GSK-3_Ddis       ------------------------------------------------------------
19912_Tthe       ------------------------------------------------------------
19923_Tthe       ------------------------------------------------------------
19924_Tthe       ------------------------------------------------------------
2636_Tthe        ------------------------------------------------------------
5825_Tthe        ----------------S-------------------------------------------
7876_Tthe        ------------------------------------------------------------
GSK3_Spur        ----------THRRPVSS------------------------------------------
n1163_Tthe       ----------------QLLQATYQGTSTEQVKHAEKELQNVSHHQDFLKYLVYIMKDTAN
CC1G_03802_Ccin  ------------------------------------------------------------
AqueK117_Aque    -------------RIRTT------------------------------------------
GSK_b_Smoe       ------------------------------------------------------------
GSK_a-2_Smoe     ------------IRGSTS------------------------------------------
GSK_a-1_Smoe     ------------IRGSTS------------------------------------------
GK035_Glam       ------------------------------------------------------------
GK036_Glam       ------------------------------------------------------------


GSK3B_Hsap       --------------------------------S---F-AES----C--------------
GSK3A_Hsap       --------------------------------S---F-AEP----G--------------
Pk34A_Dmel       --------------------------------R---H-----------------------
sgg_Dmel         --------------------------------S---L-SLP----Q--------------
gskt_Dmel        ------------------------------------L-----------------------
GSK3B_Mmus       --------------------------------S---F-AES----C--------------
GSK3A_Mmus       --------------------------------S---F-AEP----G--------------
R03D7.5_Cele     ------------------------------------------------------------
F21F3.2_Cele     ------------------------------------------------------------
C44H4.6_Cele     ------------------------------------------------------------
C36B1.10_Cele    ------------------------------------------------------------
RIM11_Scer       --------------------------------N---N--------I--------------
MRK1_Scer        --------------------------------D---NLQLKHKTSI--------------
MCK1_Scer        ------------------------------------P-----------------------
Y106G6D.4_Cele   ------------------------------------------------------------
Y106G6E.1_Cele   ------------------------------------------------------------
Y18D10A.5_Cele   --------------------------------S---L-----------------------
YOL128C_Scer     ------------------------------------P-----------------------
GlkA_Ddis        --------------------------------KGYND--------NNNNNNNNNNNNNNN
GSK-3_Ddis       ------------------------------------------------------------
19912_Tthe       --------------------------------E---VLPQQRVNA---------------
19923_Tthe       ------------------------------------------------------------
19924_Tthe       --------------------------------K---E--------V--------------
2636_Tthe        --------------------------------S--KN--------S--------------
5825_Tthe        --------------------------------Q---N--------L--------------
7876_Tthe        --------------------------------N---R--------L--------------
GSK3_Spur        --------------------------------A---Y-SKI----V--------------
n1163_Tthe       PLLMQKSASNYVHVYVRNIYSKTSQSGQIQQIQ---E--------I--------------
CC1G_03802_Ccin  ------------------------------------V-----------------------
AqueK117_Aque    --------------------------------S---F-ADP----M--------------
GSK_b_Smoe       ------------------------------------------------------------
GSK_a-2_Smoe     --------------------------------A---I-VVS-------------------
GSK_a-1_Smoe     --------------------------------A---I-VVS-------------------
GK035_Glam       ------------------------------------------------------------
GK036_Glam       ------------------------------------------------------------


GSK3B_Hsap       -K----------------------------------------------------------
GSK3A_Hsap       -G---------------GGGGGGGGPGGSASGP----GGTGGGKASVGAMGGGVGASSSG
Pk34A_Dmel       ------------------------------------------------------------
sgg_Dmel         -APPGGKWRQKQQRQQLLLSQDSGIENGVTTRPSKAKDNQGAGKASHNATS--SKESGAQ
gskt_Dmel        ------------------------------------------------------------
GSK3B_Mmus       -K----------------------------------------------------------
GSK3A_Mmus       -G---------------GGGGGGGGPGGSASGP----GGTGGGKASVGAMGGGVGASSSG
R03D7.5_Cele     ------------------------------------------------------------
F21F3.2_Cele     ------------------------------------------------------------
C44H4.6_Cele     ------------------------------------------------------------
C36B1.10_Cele    ------------------------------------------------------------
RIM11_Scer       ------------------------------------------------------------
MRK1_Scer        ------------------------------------------------------------
MCK1_Scer        ------------------------------------------------------------
Y106G6D.4_Cele   ------------------------------------------------------------
Y106G6E.1_Cele   ------------------------------------------------------------
Y18D10A.5_Cele   ------------------------------------------------------------
YOL128C_Scer     ------------------------------------------------------------
GlkA_Ddis        NN----------------------------------------------------------
GSK-3_Ddis       ------------------------------------------------------------
19912_Tthe       ------------------------------------------------------------
19923_Tthe       ------------------------------------------------------------
19924_Tthe       ------------------------------------------------------------
2636_Tthe        -I----------------------------------------------------------
5825_Tthe        ------------------------------------------------------------
7876_Tthe        ------------------------------------------------------------
GSK3_Spur        -M----------------------------------------------------------
n1163_Tthe       ------------------------------------------------------------
CC1G_03802_Ccin  ------------------------------------------------------------
AqueK117_Aque    -G----------------------------------------------------------
GSK_b_Smoe       ------------------------------------------------------------
GSK_a-2_Smoe     ------------------------------------------------------------
GSK_a-1_Smoe     ------------------------------------------------------------
GK035_Glam       ------------------------------------------------------------
GK036_Glam       ------------------------------------------------------------


GSK3B_Hsap       ---------------------------------------------P-V------------
GSK3A_Hsap       G--------------------------------GPGGSGGGGSGGP-G------------
Pk34A_Dmel       ------------------------------------------------------------
sgg_Dmel         SNSSSESLGSNCSEAQEQQRVRASSALELSSVDTPVIVGGVVSGGN-SILRSRIKYKSTN
gskt_Dmel        ------------------------------------------------------------
GSK3B_Mmus       ---------------------------------------------P-V------------
GSK3A_Mmus       G--------------------------------GPSGSGGGGSGGP-G------------
R03D7.5_Cele     ------------------------------------------------------------
F21F3.2_Cele     ------------------------------------------------------------
C44H4.6_Cele     ------------------------------------------------------------
C36B1.10_Cele    ------------------------------------------------------------
RIM11_Scer       ------------------------------------------------------------
MRK1_Scer        ------------------------------------------------------------
MCK1_Scer        ------------------------------------------------------------
Y106G6D.4_Cele   ------------------------------------------------------------
Y106G6E.1_Cele   ------------------------------------------------------------
Y18D10A.5_Cele   ------------------------------------------------------------
YOL128C_Scer     ------------------------------------------------------------
GlkA_Ddis        ------------------------------------------------------------
GSK-3_Ddis       ------------------------------------------------------------
19912_Tthe       -----------------------------------------------L------------
19923_Tthe       ------------------------------------------------------------
19924_Tthe       ------------------------------------------------------------
2636_Tthe        ------------------------------------------------------------
5825_Tthe        ------------------------------------------------------------
7876_Tthe        ------------------------------------------------------------
GSK3_Spur        ---------------------------------------------PRI------------
n1163_Tthe       ------------------------------------------------------------
CC1G_03802_Ccin  ------------------------------------------------------------
AqueK117_Aque    ----------------------------------------------RE------------
GSK_b_Smoe       ------------------------------------------------------------
GSK_a-2_Smoe     ----------------------------------------------KV------------
GSK_a-1_Smoe     ----------------------------------------------KV------------
GK035_Glam       ------------------------------------------------------------
GK036_Glam       ------------------------------------------------------------


GSK3B_Hsap       ---------------------------------------------------------Q--
GSK3A_Hsap       ------------------------------------------------------------
Pk34A_Dmel       ------------------------------------------------------------
sgg_Dmel         STGTQGFDVEDRIDEVDICDDDDVDCDDRGSEIEEEEEDQTEQEEEVDEVDAKPKNRL--
gskt_Dmel        ------------------------------------------------------------
GSK3B_Mmus       ---------------------------------------------------------Q--
GSK3A_Mmus       ------------------------------------------------------------
R03D7.5_Cele     ------------------------------------------------------------
F21F3.2_Cele     ------------------------------------------------------------
C44H4.6_Cele     ------------------------------------------------------------
C36B1.10_Cele    ------------------------------------------------------------
RIM11_Scer       ------------------------------------------------------------
MRK1_Scer        ---------------------------------------------------------Q--
MCK1_Scer        ------------------------------------------------------------
Y106G6D.4_Cele   ------------------------------------------------------------
Y106G6E.1_Cele   ------------------------------------------------------------
Y18D10A.5_Cele   ------------------------------------------------------------
YOL128C_Scer     ------------------------------------------------------------
GlkA_Ddis        ---------------------------------------------------------NNN
GSK-3_Ddis       ------------------------------------------------------------
19912_Tthe       ---------------------------------------------------------Q--
19923_Tthe       ------------------------------------------------------------
19924_Tthe       ---------------------------------------------------------L--
2636_Tthe        ---------------------------------------------------------PKA
5825_Tthe        ---------------------------------------------------------Q--
7876_Tthe        ---------------------------------------------------------N--
GSK3_Spur        ---------------------------------------------------------S--
n1163_Tthe       ---------------------------------------------------------T--
CC1G_03802_Ccin  ------------------------------------------------------------
AqueK117_Aque    ---------------------------------------------------------T--
GSK_b_Smoe       ------------------------------------------------------------
GSK_a-2_Smoe     ---------------------------------------------------------G--
GSK_a-1_Smoe     ---------------------------------------------------------G--
GK035_Glam       ------------------------------------------------------------
GK036_Glam       ------------------------------------------------------------


GSK3B_Hsap       -QP--S------------------------------------------------------
GSK3A_Hsap       -AG--T------------------------------------------------------
Pk34A_Dmel       ------------------------------------------------------------
sgg_Dmel         -LP--PDQAELTVAAAMARRRDAKSLATDGHIYFPLLKISEDPHIDSKLINRKDGLQDTM
gskt_Dmel        ------------------------------------------------------------
GSK3B_Mmus       -QP--S------------------------------------------------------
GSK3A_Mmus       -AG--T------------------------------------------------------
R03D7.5_Cele     ------------------------------------------------------------
F21F3.2_Cele     ------------------------------------------------------------
C44H4.6_Cele     ------------------------------------------------------------
C36B1.10_Cele    ------------------------------------------------------------
RIM11_Scer       ------------------------------------------------------------
MRK1_Scer        -SN--T------------------------------------------------------
MCK1_Scer        ------------------------------------------------------------
Y106G6D.4_Cele   ------------------------------------------------------------
Y106G6E.1_Cele   ------------------------------------------------------------
Y18D10A.5_Cele   ------------------------------------------------------------
YOL128C_Scer     ------------------------------------------------------------
GlkA_Ddis        N-----------------------------------------------------------
GSK-3_Ddis       ------------------------------------------------------------
19912_Tthe       -Q---Y------------------------------------------------------
19923_Tthe       ------------------------------------------------------------
19924_Tthe       ------------------------------------------------------------
2636_Tthe        FF----------------------------------------------------------
5825_Tthe        ------------------------------------------------------------
7876_Tthe        ------------------------------------------------------------
GSK3_Spur        -ST--K------------------------------------------------------
n1163_Tthe       ------------------------------------------------------------
CC1G_03802_Ccin  ------------------------------------------------------------
AqueK117_Aque    ------------------------------------------------------------
GSK_b_Smoe       ------------------------------------------------------------
GSK_a-2_Smoe     -GSGVD------------------------------------------------------
GSK_a-1_Smoe     -GSGVD------------------------------------------------------
GK035_Glam       ------------------------------------------------------------
GK036_Glam       ------------------------------------------------------------


GSK3B_Hsap       ----------------------------A-------------------------------
GSK3A_Hsap       ----------------------------S-------------------------------
Pk34A_Dmel       ------------------------------------------------------------
sgg_Dmel         YYLDEFGSPKLREKFARKQKQLLAKQQKQLMKRERRSEEQRKKRNTTVASNLAASGAVVD
gskt_Dmel        ------------------------------------------------------------
GSK3B_Mmus       ----------------------------A-------------------------------
GSK3A_Mmus       ----------------------------S-------------------------------
R03D7.5_Cele     ------------------------------------------------------------
F21F3.2_Cele     ------------------------------------------------------------
C44H4.6_Cele     ------------------------------------------------------------
C36B1.10_Cele    ------------------------------------------------------------
RIM11_Scer       ------------------------------------------------------------
MRK1_Scer        ----------------------------A-------------------------------
MCK1_Scer        ------------------------------------------------------------
Y106G6D.4_Cele   ------------------------------------------------------------
Y106G6E.1_Cele   ------------------------------------------------------------
Y18D10A.5_Cele   ------------------------------------------------------------
YOL128C_Scer     ------------------------------------------------------------
GlkA_Ddis        ------------------------------------------------------------
GSK-3_Ddis       ------------------------------------------------------------
19912_Tthe       ----------------------------A-------------------------------
19923_Tthe       ------------------------------------------------------------
19924_Tthe       ------------------------------------------------------------
2636_Tthe        ------------------------------------------------------------
5825_Tthe        ------------------------------------------------------------
7876_Tthe        ------------------------------------------------------------
GSK3_Spur        ----------------------------I-------------------------------
n1163_Tthe       ------------------------------------------------------------
CC1G_03802_Ccin  ------------------------------------------------------------
AqueK117_Aque    ------------------------------------------------------------
GSK_b_Smoe       ------------------------------------------------------------
GSK_a-2_Smoe     ----------------------------Q-------------------------------
GSK_a-1_Smoe     ----------------------------Q-------------------------------
GK035_Glam       ------------------------------------------------------------
GK036_Glam       ------------------------------------------------------------


GSK3B_Hsap       ------------------------F---------G-------------------------
GSK3A_Hsap       ------------------------F---------P-------------------------
Pk34A_Dmel       -----------------------------------A------------------------
sgg_Dmel         DTKDDYKQQPHCDTSSRSKNNSVPN---------P--P----------------------
gskt_Dmel        ------------------------------------------------------------
GSK3B_Mmus       ------------------------F---------G-------------------------
GSK3A_Mmus       ------------------------F---------P-------------------------
R03D7.5_Cele     ------------------------------------------------------------
F21F3.2_Cele     ------------------------------------------------------------
C44H4.6_Cele     ------------------------------------------------------------
C36B1.10_Cele    ------------------------------------------------------------
RIM11_Scer       ------------------------------------------------------------
MRK1_Scer        ------------------------LEK---KKRKPDTIKKVSDVQVHHTVPNFNNSSEYI
MCK1_Scer        ------------------------------------------------------------
Y106G6D.4_Cele   ------------------------------------------------------------
Y106G6E.1_Cele   ------------------------------------------------------------
Y18D10A.5_Cele   ------------------------------------------------------------
YOL128C_Scer     -----------------------------------N------------------------
GlkA_Ddis        ------------------------------NNKEHPN-----------------------
GSK-3_Ddis       ------------------------------------------------------------
19912_Tthe       ------------------------FGESPQKTKRSN---KTQD-----RVSLFNGS----
19923_Tthe       ------------------------------------------------------------
19924_Tthe       ----------------------------------PT------------------------
2636_Tthe        ------------------------FFFFFFKQFQQKN-----------------------
5825_Tthe        ----------------------------------QQ------------------------
7876_Tthe        -----------------------------------D------------------------
GSK3_Spur        ------------------------L---------PPSS----------------------
n1163_Tthe       ----------------------------------EQ------------------------
CC1G_03802_Ccin  ------------------------------------------------------------
AqueK117_Aque    ------------------------R---------PPQV----------------------
GSK_b_Smoe       ------------------------------------------------------------
GSK_a-2_Smoe     ------------------------L---------PEEM----------------------
GSK_a-1_Smoe     ------------------------L---------PEEM----------------------
GK035_Glam       ------------------------------------------------------------
GK036_Glam       ------------------------------------------------------------


GSK3B_Hsap       ------------------------------------------------------------
GSK3A_Hsap       ------------------------------------------------------------
Pk34A_Dmel       ------------------------------------------------------------
sgg_Dmel         ------------------------------------------------------------
gskt_Dmel        ------------------------------------------------------------
GSK3B_Mmus       ------------------------------------------------------------
GSK3A_Mmus       ------------------------------------------------------------
R03D7.5_Cele     ------------------------------------------------------------
F21F3.2_Cele     ------------------------------------------------------------
C44H4.6_Cele     ------------------------------------------------------------
C36B1.10_Cele    ------------------------------------------------------------
RIM11_Scer       ------------------------------------------------------------
MRK1_Scer        NDIENLIISKL-------------------------------------------------
MCK1_Scer        ------------------------------------------------------------
Y106G6D.4_Cele   ------------------------------------------------------------
Y106G6E.1_Cele   ------------------------------------------------------------
Y18D10A.5_Cele   ------------------------------------------------------------
YOL128C_Scer     ------------------------------------------------------------
GlkA_Ddis        ------------------------------------------------------------
GSK-3_Ddis       ------------------------------------------------------------
19912_Tthe       ---ASIMMTTI-------------------------------------------------
19923_Tthe       ------------------------------------------------------------
19924_Tthe       ----------Q-------------------------------------------------
2636_Tthe        ------------------------------------------------------------
5825_Tthe        ------------------------------------------------------------
7876_Tthe        ------------------------------------------------------------
GSK3_Spur        ------------------------------------------------------------
n1163_Tthe       ----------IILAMRDSNISIDCKHNISKGLSIILSLDRPQTWILQDDITQLASTLIIL
CC1G_03802_Ccin  ------------------------------------------------------------
AqueK117_Aque    ------------------------------------------------------------
GSK_b_Smoe       ------------------------------------------------------------
GSK_a-2_Smoe     ------------------------------------------------------------
GSK_a-1_Smoe     ------------------------------------------------------------
GK035_Glam       ------------------------------------------------------------
GK036_Glam       ------------------------------------------------------------


GSK3B_Hsap       ------------------------------------------------------------
GSK3A_Hsap       ------------------------------------------------------------
Pk34A_Dmel       ------------------------------------------------------------
sgg_Dmel         ------------------------------------------------------------
gskt_Dmel        ------------------------------------------------------------
GSK3B_Mmus       ------------------------------------------------------------
GSK3A_Mmus       ------------------------------------------------------------
R03D7.5_Cele     ------------------------------------------------------------
F21F3.2_Cele     ------------------------------------------------------------
C44H4.6_Cele     ------------------------------------------------------------
C36B1.10_Cele    ------------------------------------------------------------
RIM11_Scer       ------------------------------------------------------------
MRK1_Scer        ------------------------------------------------------------
MCK1_Scer        ------------------------------------------------------------
Y106G6D.4_Cele   ------------------------------------------------------------
Y106G6E.1_Cele   ------------------------------------------------------------
Y18D10A.5_Cele   ------------------------------------------------------------
YOL128C_Scer     ------------------------------------------------------------
GlkA_Ddis        ------------------------------------------------------------
GSK-3_Ddis       ------------------------------------------------------------
19912_Tthe       ------------------------------------------------------------
19923_Tthe       ------------------------------------------------------------
19924_Tthe       ------------------------------------------------------------
2636_Tthe        ------------------------------------------------------------
5825_Tthe        ------------------------------------------------------------
7876_Tthe        ------------------------------------------------------------
GSK3_Spur        ------------------------------------------------------------
n1163_Tthe       QTVIISTQQKEFLAHFFNLLNMPFCQVGSNYLTEITSSLQLLEKSQNEQETTQIFQKTVE
CC1G_03802_Ccin  ------------------------------------------------------------
AqueK117_Aque    ------------------------------------------------------------
GSK_b_Smoe       ------------------------------------------------------------
GSK_a-2_Smoe     ------------------------------------------------------------
GSK_a-1_Smoe     ------------------------------------------------------------
GK035_Glam       ------------------------------------------------------------
GK036_Glam       ------------------------------------------------------------


GSK3B_Hsap       ------------------------------------------------------------
GSK3A_Hsap       ------------------------------------------------------------
Pk34A_Dmel       ------------------------------------------------------------
sgg_Dmel         ------------------------------------------------------------
gskt_Dmel        ------------------------------------------------------------
GSK3B_Mmus       ------------------------------------------------------------
GSK3A_Mmus       ------------------------------------------------------------
R03D7.5_Cele     ------------------------------------------------------------
F21F3.2_Cele     ------------------------------------------------------------
C44H4.6_Cele     ------------------------------------------------------------
C36B1.10_Cele    ------------------------------------------------------------
RIM11_Scer       ------------------------------------------------------------
MRK1_Scer        ------------------------------------------------------------
MCK1_Scer        ------------------------------------------------------------
Y106G6D.4_Cele   ------------------------------------------------------------
Y106G6E.1_Cele   ------------------------------------------------------------
Y18D10A.5_Cele   ------------------------------------------------------------
YOL128C_Scer     ------------------------------------------------------------
GlkA_Ddis        ------------------------------------------------------------
GSK-3_Ddis       ------------------------------------------------------------
19912_Tthe       ------------------------------------------------------------
19923_Tthe       ------------------------------------------------------------
19924_Tthe       ------------------------------------------------------------
2636_Tthe        ------------------------------------------------------------
5825_Tthe        ------------------------------------------------------------
7876_Tthe        ------------------------------------------------------------
GSK3_Spur        ------------------------------------------------------------
n1163_Tthe       GIKVLNLWAIVLKDLIIQVMESKNRKLISFVLENEILANLICHGICVTLNTPLQIKDCLI
CC1G_03802_Ccin  ------------------------------------------------------------
AqueK117_Aque    ------------------------------------------------------------
GSK_b_Smoe       ------------------------------------------------------------
GSK_a-2_Smoe     ------------------------------------------------------------
GSK_a-1_Smoe     ------------------------------------------------------------
GK035_Glam       ------------------------------------------------------------
GK036_Glam       ------------------------------------------------------------


GSK3B_Hsap       ------------------------------------------------------------
GSK3A_Hsap       ------------------------------------------------------------
Pk34A_Dmel       ------------------------------------------------------------
sgg_Dmel         ------------------------------------------------------------
gskt_Dmel        ------------------------------------------------------------
GSK3B_Mmus       ------------------------------------------------------------
GSK3A_Mmus       ------------------------------------------------------------
R03D7.5_Cele     ------------------------------------------------------------
F21F3.2_Cele     ------------------------------------------------------------
C44H4.6_Cele     ------------------------------------------------------------
C36B1.10_Cele    ------------------------------------------------------------
RIM11_Scer       ------------------------------------------------------------
MRK1_Scer        ------------------------------------------------------------
MCK1_Scer        ------------------------------------------------------------
Y106G6D.4_Cele   ------------------------------------------------------------
Y106G6E.1_Cele   ------------------------------------------------------------
Y18D10A.5_Cele   ------------------------------------------------------------
YOL128C_Scer     ------------------------------------------------------------
GlkA_Ddis        ------------------------------------------------------------
GSK-3_Ddis       ------------------------------------------------------------
19912_Tthe       ------------------------------------------------------------
19923_Tthe       ------------------------------------------------------------
19924_Tthe       ------------------------------------------------------------
2636_Tthe        ------------------------------------------------------------
5825_Tthe        ------------------------------------------------------------
7876_Tthe        ------------------------------------------------------------
GSK3_Spur        ------------------------------------------------------------
n1163_Tthe       CTSGQSDFDDAANTLKSHLIKAYTRINRQMFAERSKFDIFKTQFFKLLQQSLPIILKGLM
CC1G_03802_Ccin  ------------------------------------------------------------
AqueK117_Aque    ------------------------------------------------------------
GSK_b_Smoe       ------------------------------------------------------------
GSK_a-2_Smoe     ------------------------------------------------------------
GSK_a-1_Smoe     ------------------------------------------------------------
GK035_Glam       ------------------------------------------------------------
GK036_Glam       ------------------------------------------------------------


GSK3B_Hsap       ------------------------------------------------------------
GSK3A_Hsap       ------------------------------------------------------------
Pk34A_Dmel       ------------------------------------------------------------
sgg_Dmel         ------------------------------------------------------------
gskt_Dmel        ------------------------------------------------------------
GSK3B_Mmus       ------------------------------------------------------------
GSK3A_Mmus       ------------------------------------------------------------
R03D7.5_Cele     ------------------------------------------------------------
F21F3.2_Cele     ------------------------------------------------------------
C44H4.6_Cele     ------------------------------------------------------------
C36B1.10_Cele    ------------------------------------------------------------
RIM11_Scer       ------------------------------------------------------------
MRK1_Scer        ------------------------------------------------------------
MCK1_Scer        ------------------------------------------------------------
Y106G6D.4_Cele   ------------------------------------------------------------
Y106G6E.1_Cele   ------------------------------------------------------------
Y18D10A.5_Cele   ------------------------------------------------------------
YOL128C_Scer     ------------------------------------------------------------
GlkA_Ddis        ------------------------------------------------------------
GSK-3_Ddis       ------------------------------------------------------------
19912_Tthe       ------------------------------------------------------------
19923_Tthe       ------------------------------------------------------------
19924_Tthe       ------------------------------------------------------------
2636_Tthe        ------------------------------------------------------------
5825_Tthe        ------------------------------------------------------------
7876_Tthe        ------------------------------------------------------------
GSK3_Spur        ------------------------------------------------------------
n1163_Tthe       LFCQQTPDFQDKLENKSLSSIVIECLKFSHICAEQSEFYKIFQDCSRVLLLEVIFPLMRS
CC1G_03802_Ccin  ------------------------------------------------------------
AqueK117_Aque    ------------------------------------------------------------
GSK_b_Smoe       ------------------------------------------------------------
GSK_a-2_Smoe     ------------------------------------------------------------
GSK_a-1_Smoe     ------------------------------------------------------------
GK035_Glam       ------------------------------------------------------------
GK036_Glam       ------------------------------------------------------------


GSK3B_Hsap       ------------------------------------------------------------
GSK3A_Hsap       ------------------------------------------------------------
Pk34A_Dmel       ------------------------------------------------------------
sgg_Dmel         ------------------------------------------------------------
gskt_Dmel        ------------------------------------------------------------
GSK3B_Mmus       ------------------------------------------------------------
GSK3A_Mmus       ------------------------------------------------------------
R03D7.5_Cele     ------------------------------------------------------------
F21F3.2_Cele     ------------------------------------------------------------
C44H4.6_Cele     ------------------------------------------------------------
C36B1.10_Cele    ------------------------------------------------------------
RIM11_Scer       ------------------------------------------------------------
MRK1_Scer        ------------------------------------------------------------
MCK1_Scer        ------------------------------------------------------------
Y106G6D.4_Cele   ------------------------------------------------------------
Y106G6E.1_Cele   ------------------------------------------------------------
Y18D10A.5_Cele   ------------------------------------------------------------
YOL128C_Scer     ------------------------------------------------------------
GlkA_Ddis        ------------------------------------------------------------
GSK-3_Ddis       ------------------------------------------------------------
19912_Tthe       ------------------------------------------------------------
19923_Tthe       ------------------------------------------------------------
19924_Tthe       ------------------------------------------------------------
2636_Tthe        ------------------------------------------------------------
5825_Tthe        ------------------------------------------------------------
7876_Tthe        ------------------------------------------------------------
GSK3_Spur        ------------------------------------------------------------
n1163_Tthe       SQSEQESLENNPEEFVRLALDTCDRQISYSYKCAAAKLLETVCDYIDGFETIVSLLLIQI
CC1G_03802_Ccin  ------------------------------------------------------------
AqueK117_Aque    ------------------------------------------------------------
GSK_b_Smoe       ------------------------------------------------------------
GSK_a-2_Smoe     ------------------------------------------------------------
GSK_a-1_Smoe     ------------------------------------------------------------
GK035_Glam       ------------------------------------------------------------
GK036_Glam       ------------------------------------------------------------


GSK3B_Hsap       ------------------------------------------------------------
GSK3A_Hsap       ------------------------------------------------------------
Pk34A_Dmel       ------------------------------------------------------------
sgg_Dmel         ------------------------------------------------------------
gskt_Dmel        ------------------------------------------------------------
GSK3B_Mmus       ------------------------------------------------------------
GSK3A_Mmus       ------------------------------------------------------------
R03D7.5_Cele     ------------------------------------------------------------
F21F3.2_Cele     ------------------------------------------------------------
C44H4.6_Cele     ------------------------------------------------------------
C36B1.10_Cele    ------------------------------------------------------------
RIM11_Scer       ------------------------------------------------------------
MRK1_Scer        ------------------------------------------------------------
MCK1_Scer        ------------------------------------------------------------
Y106G6D.4_Cele   ------------------------------------------------------------
Y106G6E.1_Cele   ------------------------------------------------------------
Y18D10A.5_Cele   ------------------------------------------------------------
YOL128C_Scer     ------------------------------------------------------------
GlkA_Ddis        ------------------------------------------------------------
GSK-3_Ddis       ------------------------------------------------------------
19912_Tthe       ------------------------------------------------------------
19923_Tthe       ------------------------------------------------------------
19924_Tthe       ------------------------------------------------------------
2636_Tthe        ------------------------------------------------------------
5825_Tthe        ------------------------------------------------------------
7876_Tthe        ------------------------------------------------------------
GSK3_Spur        ------------------------------------------------------------
n1163_Tthe       VGFSIKFENITDVDANYPNLIPFKETVFMSKTERHIRIETCFVALSVLSYLTPKRPDIVG
CC1G_03802_Ccin  ------------------------------------------------------------
AqueK117_Aque    ------------------------------------------------------------
GSK_b_Smoe       ------------------------------------------------------------
GSK_a-2_Smoe     ------------------------------------------------------------
GSK_a-1_Smoe     ------------------------------------------------------------
GK035_Glam       ------------------------------------------------------------
GK036_Glam       ------------------------------------------------------------


GSK3B_Hsap       ------------------------------------------------------------
GSK3A_Hsap       ------------------------------------------------------------
Pk34A_Dmel       ------------------------------------------------------------
sgg_Dmel         ------------------------------------------------------------
gskt_Dmel        ------------------------------------------------------------
GSK3B_Mmus       ------------------------------------------------------------
GSK3A_Mmus       ------------------------------------------------------------
R03D7.5_Cele     ------------------------------------------------------------
F21F3.2_Cele     ------------------------------------------------------------
C44H4.6_Cele     ------------------------------------------------------------
C36B1.10_Cele    ------------------------------------------------------------
RIM11_Scer       ------------------------------------------------------------
MRK1_Scer        ------------------------------------------------------------
MCK1_Scer        ------------------------------------------------------------
Y106G6D.4_Cele   ------------------------------------------------------------
Y106G6E.1_Cele   ------------------------------------------------------------
Y18D10A.5_Cele   ------------------------------------------------------------
YOL128C_Scer     ------------------------------------------------------------
GlkA_Ddis        ------------------------------------------------------------
GSK-3_Ddis       ------------------------------------------------------------
19912_Tthe       ------------------------------------------------------------
19923_Tthe       ------------------------------------------------------------
19924_Tthe       ------------------------------------------------------------
2636_Tthe        ------------------------------------------------------------
5825_Tthe        ------------------------------------------------------------
7876_Tthe        ------------------------------------------------------------
GSK3_Spur        ------------------------------------------------------------
n1163_Tthe       QIELLLKEHAQFLFNHNIHRLIKVRVCLMLGYYTDSVFQNEKENYKSLIQFLLSCLTLKE
CC1G_03802_Ccin  ------------------------------------------------------------
AqueK117_Aque    ------------------------------------------------------------
GSK_b_Smoe       ------------------------------------------------------------
GSK_a-2_Smoe     ------------------------------------------------------------
GSK_a-1_Smoe     ------------------------------------------------------------
GK035_Glam       ------------------------------------------------------------
GK036_Glam       ------------------------------------------------------------


GSK3B_Hsap       ------------------------------------------------------------
GSK3A_Hsap       ------------------------------------------------------------
Pk34A_Dmel       ------------------------------------------------------------
sgg_Dmel         ------------------------------------------------------------
gskt_Dmel        ------------------------------------------------------------
GSK3B_Mmus       ------------------------------------------------------------
GSK3A_Mmus       ------------------------------------------------------------
R03D7.5_Cele     ------------------------------------------------------------
F21F3.2_Cele     ------------------------------------------------------------
C44H4.6_Cele     ------------------------------------------------------------
C36B1.10_Cele    ------------------------------------------------------------
RIM11_Scer       ------------------------------------------------------------
MRK1_Scer        -IDGG-------------------------------------------------------
MCK1_Scer        ------------------------------------------------------------
Y106G6D.4_Cele   ------------------------------------------------------------
Y106G6E.1_Cele   ------------------------------------------------------------
Y18D10A.5_Cele   ------------------------------------------------------------
YOL128C_Scer     ------------------------------------------------------------
GlkA_Ddis        ------------------------------------------------------------
GSK-3_Ddis       ------------------------------------------------------------
19912_Tthe       -Q----------------------------------------------------------
19923_Tthe       ------------------------------------------------------------
19924_Tthe       -ADEG-------------------------------------------------------
2636_Tthe        ------------------------------------------------------------
5825_Tthe        ------------------------------------------------------------
7876_Tthe        ------------------------------------------------------------
GSK3_Spur        ------------------------------------------------------------
n1163_Tthe       QEDQGIVYQAIDSLQNIYDDDNQVNLVSENINEVLHVILPLITTTEFHQFMDIVFHIFRY
CC1G_03802_Ccin  ------------------------------------------------------------
AqueK117_Aque    ------------------------------------------------------------
GSK_b_Smoe       ------------------------------------------------------------
GSK_a-2_Smoe     ------------------------------------------------------------
GSK_a-1_Smoe     ------------------------------------------------------------
GK035_Glam       ------------------------------------------------------------
GK036_Glam       ------------------------------------------------------------


GSK3B_Hsap       ------------------------------------------------------------
GSK3A_Hsap       ------------------------------------------------------------
Pk34A_Dmel       ------------------------------------------------------------
sgg_Dmel         ------------------------------------------------------------
gskt_Dmel        ------------------------------------------------------------
GSK3B_Mmus       ------------------------------------------------------------
GSK3A_Mmus       ------------------------------------------------------------
R03D7.5_Cele     ------------------------------------------------------------
F21F3.2_Cele     ------------------------------------------------------------
C44H4.6_Cele     ------------------------------------------------------------
C36B1.10_Cele    ------------------------------------------------------------
RIM11_Scer       ------------------------------------------------------------
MRK1_Scer        ------------------------------------------------------------
MCK1_Scer        ------------------------------------------------------------
Y106G6D.4_Cele   ------------------------------------------------------------
Y106G6E.1_Cele   ------------------------------------------------------------
Y18D10A.5_Cele   ------------------------------------------------------------
YOL128C_Scer     ------------------------------------------------------------
GlkA_Ddis        ------------------------------------------------------------
GSK-3_Ddis       ------------------------------------------------------------
19912_Tthe       ------------------------------------------------------------
19923_Tthe       ------------------------------------------------------------
19924_Tthe       ------------------------------------------------------------
2636_Tthe        ------------------------------------------------------------
5825_Tthe        ------------------------------------------------------------
7876_Tthe        ------------------------------------------------------------
GSK3_Spur        ------------------------------------------------------------
n1163_Tthe       HSKNIAPQNIINCVGYLVKRIIDEVKLIDDKLRNDQIYINKCWNIIRDMSDNKFIVPQYI
CC1G_03802_Ccin  ------------------------------------------------------------
AqueK117_Aque    ------------------------------------------------------------
GSK_b_Smoe       ------------------------------------------------------------
GSK_a-2_Smoe     ------------------------------------------------------------
GSK_a-1_Smoe     ------------------------------------------------------------
GK035_Glam       ------------------------------------------------------------
GK036_Glam       ------------------------------------------------------------


GSK3B_Hsap       ------------------------------------------------------------
GSK3A_Hsap       ------------------------------------------------------------
Pk34A_Dmel       ------------------------------------------------------------
sgg_Dmel         ------------------------------------------------------------
gskt_Dmel        ------------------------------------------------------------
GSK3B_Mmus       ------------------------------------------------------------
GSK3A_Mmus       ------------------------------------------------------------
R03D7.5_Cele     ------------------------------------------------------------
F21F3.2_Cele     ------------------------------------------------------------
C44H4.6_Cele     ------------------------------------------------------------
C36B1.10_Cele    ------------------------------------------------------------
RIM11_Scer       ------------------------------------------------------------
MRK1_Scer        ------------------------------------------------------------
MCK1_Scer        ------------------------------------------------------------
Y106G6D.4_Cele   ------------------------------------------------------------
Y106G6E.1_Cele   ------------------------------------------------------------
Y18D10A.5_Cele   ------------------------------------------------------------
YOL128C_Scer     ------------------------------------------------------------
GlkA_Ddis        ------------------------------------------------------------
GSK-3_Ddis       ------------------------------------------------------------
19912_Tthe       ------------------------------------------------------------
19923_Tthe       ------------------------------------------------------------
19924_Tthe       ------------------------------------------------------------
2636_Tthe        ------------------------------------------------------------
5825_Tthe        ------------------------------------------------------------
7876_Tthe        ------------------------------------------------------------
GSK3_Spur        ------------------------------------------------------------
n1163_Tthe       NSILEQLRPLLQCVQYPEKIEFDEDIILLVGSFIYHQKAVNPICSDLITCFPLILKKQQG
CC1G_03802_Ccin  ------------------------------------------------------------
AqueK117_Aque    ------------------------------------------------------------
GSK_b_Smoe       ------------------------------------------------------------
GSK_a-2_Smoe     ------------------------------------------------------------
GSK_a-1_Smoe     ------------------------------------------------------------
GK035_Glam       ------------------------------------------------------------
GK036_Glam       ------------------------------------------------------------


GSK3B_Hsap       ------------------------------------------------------------
GSK3A_Hsap       ------------------------------------------------------------
Pk34A_Dmel       ------------------------------------------------------------
sgg_Dmel         ------------------------------------------------------------
gskt_Dmel        ------------------------------------------------------------
GSK3B_Mmus       ------------------------------------------------------------
GSK3A_Mmus       ------------------------------------------------------------
R03D7.5_Cele     ------------------------------------------------------------
F21F3.2_Cele     ------------------------------------------------------------
C44H4.6_Cele     ------------------------------------------------------------
C36B1.10_Cele    ------------------------------------------------------------
RIM11_Scer       ------------------------------------------------------------
MRK1_Scer        --------------------------------------------