Protein (view, download) , Domain (view, download)
PLK4_Hsap_SAK                 MATC--------------------------------------------------------
PLK3_Hsap_PLK2                MEPAAGF-----------------L--S-P------------------------------
PLK2_Hsap_PLK2                MELLRTI-----------------T--YQPA-AST------K------------------
PLK1_Hsap_PLK1                MSAAVTA-----------------G--K-L------------------------------
polo_Dmel_PLK1                MAAKPED-----------------K-----------------------------------
SAK_Dmel_SAK                  MLSNRA------------------------------------------------------
PLK5_Mmus_PLK2                MEPRSRR-----------------------------------------------------
PLK4_Mmus_SAK                 MAAC--------------------------------------------------------
PLK3_Mmus_PLK2                MEPAAGF-----------------L--S-P------------------------------
PLK2_Mmus_PLK2                MELLRTI-----------------T--YQPA-AGT------K------------------
PLK1_Mmus_PLK1                MNAAAKA-----------------G--K-L------------------------------
plk-2_Cele_PLK1               MQRVQPS-----------------A-----------------------------------
plk-1_Cele_PLK1               MNRLPNI-----------------A--K-P------------------------------
F55G1.8_Cele_PLK1             MQHVLRT-----------------R-----------------------------------
CDC5_Scer_PLK1                MSLGPLK-----------------AIND------------------------KQLNTRSK
zyg-1_Cele_SAK                MSGGKSG-----------------------------------------------------
PLK_Ddis_PLK1                 MVSINQN-----------------F--KLPI-SMNSQ-------PIQ--IQQQQFK----
8635_Tthe_SAK                 MQGLA-------------------------------------------------------
18358b_Tthe_PLK-Unclassified  ------------------------------------------------------------
18380_Tthe_PLK-Unclassified   MSYFKNI-----------------F--KLRLRDFDKEGVVVFLVEVQLTVENKQFM----
21183_Tthe_SAK                MIQQK-------------------------------------------------------
22503_Tthe_PLK-Unclassified   MSTEN-------------------------------------------------------
5034_Tthe_SAK                 MFSQE-------------------------------------------------------
8829_Tthe_PLK-Unclassified    MDKAN-------------------------------------------------------
SAK_Spur_SAK                  ME----------------------------------------------------------
PLK1_Spur_PLK1                MASRHKE-----------------D-----------------------------------
PLK2_Spur_PLK2                MPLTRSPVLPVGLSKDVRYTMDQLQ--K-P------------------------------
n1170_Tthe_PLK-Unclassified   MSNQD-------------------------------------------------------
n808_Tthe_PLK-Unclassified    MSNQD-------------------------------------------------------
CC1G_07437_Ccin_PLK1          MYQMNGY-----------------R--M-P------------------------------
AqueK200_Aque_PLK1            MAHHLSE-----------------K--D-K------------------------------
AqueK201_Aque_SAK             ------------------------------------------------------------
GK066_Glam_PLK-Unclassified   MSHSNAP-----------------------------------------------------


PLK4_Hsap_SAK                 ------------------------------------------------------------
PLK3_Hsap_PLK2                ---------------------RP-------------------------------------
PLK2_Hsap_PLK2                MCE------------------QA-----------LGKGCGA-------------------
PLK1_Hsap_PLK1                ------------------------------------------------------------
polo_Dmel_PLK1                ------------------------------------------------------------
SAK_Dmel_SAK                  ------------------------------------------------------------
PLK5_Mmus_PLK2                ------------------------------------------------------------
PLK4_Mmus_SAK                 ------------------------------------------------------------
PLK3_Mmus_PLK2                ---------------------RP-------------------------------------
PLK2_Mmus_PLK2                MCE------------------QA-----------LGKACGG-------------------
PLK1_Mmus_PLK1                ------------------------------------------------------------
plk-2_Cele_PLK1               ------------------------------------------------------------
plk-1_Cele_PLK1               ------------------------------------------------------------
F55G1.8_Cele_PLK1             ------------------------------------------------------------
CDC5_Scer_PLK1                LVHTPIKGNTADLVGKENHFKQTKRLDPNND-----------------------------
zyg-1_Cele_SAK                ------------------------------------------------------------
PLK_Ddis_PLK1                 -QP------------------QQ-------QPQQKSNSCFSDQENYPANIQPSSSTSSSS
8635_Tthe_SAK                 ------------------------------Q-----------------------------
18358b_Tthe_PLK-Unclassified  ------------------------------------------------------------
18380_Tthe_PLK-Unclassified   -SQ------------------QA-------A-----------------------------
21183_Tthe_SAK                ------------------------------K-----------------------------
22503_Tthe_PLK-Unclassified   ------------------------------Q-----------------------------
5034_Tthe_SAK                 ------------------------------E-----------------------------
8829_Tthe_PLK-Unclassified    ------------------------------E-----------------------------
SAK_Spur_SAK                  ------------------------------------------------------------
PLK1_Spur_PLK1                ------------------------------------------------------------
PLK2_Spur_PLK2                ------------------------------------------------------------
n1170_Tthe_PLK-Unclassified   ------------------------------K-----------------------------
n808_Tthe_PLK-Unclassified    ------------------------------K-----------------------------
CC1G_07437_Ccin_PLK1          ------------------------------------------------------------
AqueK200_Aque_PLK1            ------------------------------------------------------------
AqueK201_Aque_SAK             ------------------------------------------------------------
GK066_Glam_PLK-Unclassified   ------------------------------------------------------------


PLK4_Hsap_SAK                 ------------------------------------------------------------
PLK3_Hsap_PLK2                ---------------------F----------------------------------QRA-
PLK2_Hsap_PLK2                ---------------------D----------------------------------SKK-
PLK1_Hsap_PLK1                ----------------------------------------------------------A-
polo_Dmel_PLK1                ------------------------------------------------------------
SAK_Dmel_SAK                  ------------------------------------------------------------
PLK5_Mmus_PLK2                ------------------------------------------------------------
PLK4_Mmus_SAK                 ------------------------------------------------------------
PLK3_Mmus_PLK2                ---------------------F----------------------------------PRA-
PLK2_Mmus_PLK2                ---------------------D----------------------------------SKK-
PLK1_Mmus_PLK1                ----------------------------------------------------------A-
plk-2_Cele_PLK1               ----------------------------------------------------------A-
plk-1_Cele_PLK1               ----------------------------------------------------------P-
F55G1.8_Cele_PLK1             ----------------------------------------------------------G-
CDC5_Scer_PLK1                --------------------------------------------------------HHH-
zyg-1_Cele_SAK                ------------------------------------------------------------
PLK_Ddis_PLK1                 SSSIHITKSMVIRPPLESNQPQPQQQQQQQQTLQQIHHQQVQLQQQQSLQMQQQQLQQQ-
8635_Tthe_SAK                 --------------------------------------------------------TPFD
18358b_Tthe_PLK-Unclassified  ------------------------------------------------------------
18380_Tthe_PLK-Unclassified   --------------------------------------------------------QQQ-
21183_Tthe_SAK                --------------------------------------------------------DQK-
22503_Tthe_PLK-Unclassified   --------------------------------------------------------NQQ-
5034_Tthe_SAK                 --------------------------------------------------------AKE-
8829_Tthe_PLK-Unclassified    --------------------------------------------------------GKD-
SAK_Spur_SAK                  ------------------------------------------------------------
PLK1_Spur_PLK1                ------------------------------------------------------------
PLK2_Spur_PLK2                ----------------------------------------------------------A-
n1170_Tthe_PLK-Unclassified   --------------------------------------------------------QQQ-
n808_Tthe_PLK-Unclassified    --------------------------------------------------------QQQ-
CC1G_07437_Ccin_PLK1          ----------------------------------------------------------P-
AqueK200_Aque_PLK1            ----------------------------------------------------------L-
AqueK201_Aque_SAK             ------------------------------------------------------------
GK066_Glam_PLK-Unclassified   ------------------------------------------------------------


PLK4_Hsap_SAK                 ------------------------------------------------------------
PLK3_Hsap_PLK2                ---A--AAPAPPA-------------------GPGP------------------------
PLK2_Hsap_PLK2                ---K--RPPQPPE-------------------ESQP------------------------
PLK1_Hsap_PLK1                ---R--APADPGK-------------------AGVP------------------------
polo_Dmel_PLK1                ------------------------------------------------------------
SAK_Dmel_SAK                  ------------------------------------------------------------
PLK5_Mmus_PLK2                ------------------------------------------------------------
PLK4_Mmus_SAK                 ------------------------------------------------------------
PLK3_Mmus_PLK2                ---A--APSAPPA-------------------GPGP------------------------
PLK2_Mmus_PLK2                ---K--RPQQPSE-------------------DGQP------------------------
PLK1_Mmus_PLK1                ---R--APADLGK-------------------GGVP------------------------
plk-2_Cele_PLK1               ---R--VKSQ--------------------------------------------------
plk-1_Cele_PLK1               ---Q--KSNQ--------------------------------------------------
F55G1.8_Cele_PLK1             ---N--SAQDKNK-----------------------------------------------
CDC5_Scer_PLK1                ---Q--PAQKKKR-----------------------------------------------
zyg-1_Cele_SAK                ------------------------------------------------------------
PLK_Ddis_PLK1                 ---Q--QQ-QQQQ-------------------QMPP------------------------
8635_Tthe_SAK                 LFEPQQRLFRLPQ-------------------KKSGVLKQQIFKEFIEKAQIKIKILDEE
18358b_Tthe_PLK-Unclassified  ------------------------------------------------------------
18380_Tthe_PLK-Unclassified   ---P--QQ-KQSE-------------------QGQN------------------------
21183_Tthe_SAK                ---P--KSSS--Q-------------------Q---------------------------
22503_Tthe_PLK-Unclassified   ---Q--KPAQDPV-------------------SCY-------------------------
5034_Tthe_SAK                 ---Q--NSDEQNQ-------------------E---------------------------
8829_Tthe_PLK-Unclassified    ---Q--------------------------------------------------------
SAK_Spur_SAK                  ------------------------------------------------------------
PLK1_Spur_PLK1                ------------------------------------------------------------
PLK2_Spur_PLK2                ---P-LSPEDTPKTTPS---LSSKPHGAGREENVKP------------------------
n1170_Tthe_PLK-Unclassified   ---Q--QQ-QQPQ-------------------GAQR------------------------
n808_Tthe_PLK-Unclassified    ---Q--QQ-QQPQ-------------------GAQR------------------------
CC1G_07437_Ccin_PLK1          ---A--APGPSSKRNPLVNAVNHHPNV--MQMNAVP------------------------
AqueK200_Aque_PLK1            ---G--S-----------------------------------------------------
AqueK201_Aque_SAK             ------------------------------------------------------------
GK066_Glam_PLK-Unclassified   ------------------------------------------------------------


PLK4_Hsap_SAK                 ------------------------------------------------------------
PLK3_Hsap_PLK2                ------------------------------------------------------------
PLK2_Hsap_PLK2                ------------------------------------------------------------
PLK1_Hsap_PLK1                ------------------------------------------------------------
polo_Dmel_PLK1                ------------------------------------------------------------
SAK_Dmel_SAK                  ------------------------------------------------------------
PLK5_Mmus_PLK2                ------------------------------------------------------------
PLK4_Mmus_SAK                 ------------------------------------------------------------
PLK3_Mmus_PLK2                ------------------------------------------------------------
PLK2_Mmus_PLK2                ------------------------------------------------------------
PLK1_Mmus_PLK1                ------------------------------------------------------------
plk-2_Cele_PLK1               ------------------------------------------------------------
plk-1_Cele_PLK1               ------------------------------------------------------------
F55G1.8_Cele_PLK1             ------------------------------------------------------------
CDC5_Scer_PLK1                ------------------------------------------------------------
zyg-1_Cele_SAK                ------------------------------------------------------------
PLK_Ddis_PLK1                 ------------------------------------------------------------
8635_Tthe_SAK                 NDNEVLFYTPILFGYLSLIILKESSSTIILKHTLCYCNGKPYLIKDHQIRLLFTRCLNKI
18358b_Tthe_PLK-Unclassified  ------------------------------------------------------------
18380_Tthe_PLK-Unclassified   ------------------------------------------------------------
21183_Tthe_SAK                ------------------------------------------------------------
22503_Tthe_PLK-Unclassified   ------------------------------------------------------------
5034_Tthe_SAK                 ------------------------------------------------------------
8829_Tthe_PLK-Unclassified    ------------------------------------------------------------
SAK_Spur_SAK                  ------------------------------------------------------------
PLK1_Spur_PLK1                ------------------------------------------------------------
PLK2_Spur_PLK2                ------------------------------------------------------------
n1170_Tthe_PLK-Unclassified   ------------------------------------------------------------
n808_Tthe_PLK-Unclassified    ------------------------------------------------------------
CC1G_07437_Ccin_PLK1          ------------------------------------------------------------
AqueK200_Aque_PLK1            ------------------------------------------------------------
AqueK201_Aque_SAK             ------------------------------------------------------------
GK066_Glam_PLK-Unclassified   ------------------------------------------------------------


PLK4_Hsap_SAK                 ------------------------------------------------------------
PLK3_Hsap_PLK2                ------------P--P--------------------------------------------
PLK2_Hsap_PLK2                ------------P--Q--------------------------------------------
PLK1_Hsap_PLK1                ---------------G--------------------------------------------
polo_Dmel_PLK1                ------------------------------------------------------------
SAK_Dmel_SAK                  ------------------------------------------------------------
PLK5_Mmus_PLK2                ------------------------------------------------------------
PLK4_Mmus_SAK                 ------------------------------------------------------------
PLK3_Mmus_PLK2                ------------P--A--------------------------------------------
PLK2_Mmus_PLK2                ---------------Q--------------------------------------------
PLK1_Mmus_PLK1                ---------------G--------------------------------------------
plk-2_Cele_PLK1               ------------------------------------------------------------
plk-1_Cele_PLK1               ------------------------------------------------------------
F55G1.8_Cele_PLK1             ------------------------------------------------------------
CDC5_Scer_PLK1                ------------------------------------------------------------
zyg-1_Cele_SAK                ------------------------------------------------------------
PLK_Ddis_PLK1                 ------------P--QS-------------------------------------------
8635_Tthe_SAK                 NNIEKFSKYAMNP--RNGEISLKDALFFEKETFQKFNESPLLAIKPMLELYNQQIHILKQ
18358b_Tthe_PLK-Unclassified  ------------------------------------------------------------
18380_Tthe_PLK-Unclassified   ------------N--NN-------------------------------------------
21183_Tthe_SAK                ------------------------------------------------------------
22503_Tthe_PLK-Unclassified   ------------------------------------------------------------
5034_Tthe_SAK                 ------------------------------------------------------------
8829_Tthe_PLK-Unclassified    ------------------------------------------------------------
SAK_Spur_SAK                  ------------------------------------------------------------
PLK1_Spur_PLK1                ------------------------------------------------------------
PLK2_Spur_PLK2                ------------PIPP--------------------------------------------
n1170_Tthe_PLK-Unclassified   ------------------------------------------------------------
n808_Tthe_PLK-Unclassified    ------------------------------------------------------------
CC1G_07437_Ccin_PLK1          ------------PVPA--------------------------------------------
AqueK200_Aque_PLK1            ------------------------------------------------------------
AqueK201_Aque_SAK             ------------------------------------------------------------
GK066_Glam_PLK-Unclassified   ------------------------------------------------------------


PLK4_Hsap_SAK                 ------------------------------------------------------------
PLK3_Hsap_PLK2                -----------SA----LR-----------------------------------------
PLK2_Hsap_PLK2                -----------SQ-AQVPP-----------------------------------------
PLK1_Hsap_PLK1                -----------VA----AP-----------------------------------------
polo_Dmel_PLK1                ------------------------------------------------------------
SAK_Dmel_SAK                  ------------------------------------------------------------
PLK5_Mmus_PLK2                ------------------------------------------------------------
PLK4_Mmus_SAK                 ------------------------------------------------------------
PLK3_Mmus_PLK2                -----------NA----SP-----------------------------------------
PLK2_Mmus_PLK2                --------------AQVTP-----------------------------------------
PLK1_Mmus_PLK1                -----------DA----VP-----------------------------------------
plk-2_Cele_PLK1               ------------------------------------------------------------
plk-1_Cele_PLK1               ------------------------------------------------------------
F55G1.8_Cele_PLK1             ------------------------------------------------------------
CDC5_Scer_PLK1                ------------------------------------------------------------
zyg-1_Cele_SAK                ------------------------------------------------------------
PLK_Ddis_PLK1                 -----------LP----NK-----------------------------------------
8635_Tthe_SAK                 YTKLILVVLEELP----QIFNQYSDISFLSLNQINLQLLKVKMWLIDPDTFEDQSEINEQ
18358b_Tthe_PLK-Unclassified  ------------------------------------------------------------
18380_Tthe_PLK-Unclassified   -----------DQ----GV-----------------------------------------
21183_Tthe_SAK                ------------------------------------------------------------
22503_Tthe_PLK-Unclassified   ------------------------------------------------------------
5034_Tthe_SAK                 ------------------------------------------------------------
8829_Tthe_PLK-Unclassified    ------------------------------------------------------------
SAK_Spur_SAK                  ------------------------------------------------------------
PLK1_Spur_PLK1                ------------------------------------------------------------
PLK2_Spur_PLK2                -----------AR----AP-----------------------------------------
n1170_Tthe_PLK-Unclassified   ------------------------------------------------------------
n808_Tthe_PLK-Unclassified    ------------------------------------------------------------
CC1G_07437_Ccin_PLK1          -----------KAPAKG-P-----------------------------------------
AqueK200_Aque_PLK1            ------------------------------------------------------------
AqueK201_Aque_SAK             ------------------------------------------------------------
GK066_Glam_PLK-Unclassified   ------------------------------------------------------------


PLK4_Hsap_SAK                 ------------------------I-G-EKIEDFKVGNLLGKGSFAGVYR----------
PLK3_Hsap_PLK2                -G-PE-LEMLAG-LPTSDP-GRLIT-DPRSGRTYLKGRLLGKGGFARCYE----------
PLK2_Hsap_PLK2                -AAPH-HHHHH-SHSGPEI-SRIIV-DPTTGKRYCRGKVLGKGGFAKCYE----------
PLK1_Hsap_PLK1                -GAP-----AA-APPAKEI-PEVLV-DPRSRRRYVRGRFLGKGGFAKCFE----------
polo_Dmel_PLK1                ---------------STDI-PDRLV-DINQRKTYKRMRFFGKGGFAKCYE----------
SAK_Dmel_SAK                  ------------------------F-G-ETIEDYEVQHLLGKGGFATVYK----------
PLK5_Mmus_PLK2                ------------RRSRQLV-ATFLR-DPGSGRVYRRGKLIGKGAFSRCYK----------
PLK4_Mmus_SAK                 ------------------------I-G-ERIEDFKVGNLLGKGSFAGVYR----------
PLK3_Mmus_PLK2                -R-SE-PEVLAGPRAPDPP-GRLIT-DPLSGRTYTKGRLLGKGGFARCYE----------
PLK2_Mmus_PLK2                -AAPH-HHHHH-SHSGPEI-SRIIV-DPTTGKRYCRGKVLGKGGFAKCYE----------
PLK1_Mmus_PLK1                -GAP-----VA-APLAKEI-PEVLV-DPRSRRQYVRGRFLGKGGFAKCFE----------
plk-2_Cele_PLK1               ---------KK-EKAPPDV-PDVIL-DGERKTRYEKGKFLGKGGFAHCYE----------
plk-1_Cele_PLK1               ---------RK-EKAPPEV-PALIA-DKDRGTYYEKGRFLGKGGFAHCYE----------
F55G1.8_Cele_PLK1             ------------KH-VPNV-PPIIY-D-DMQVPYEKGAFLGEGGFAHCFE----------
CDC5_Scer_PLK1                ----E----KL-SA-LCKT-PPSLI-K-TRGKDYHRGHFLGEGGFARCFQ----------
zyg-1_Cele_SAK                ----------------------------SRLSAYSHLKEIGKGGFGVVYA----------
PLK_Ddis_PLK1                 -SNEP----QE-PIVVYET-IR-SG-DSKRLKEYRQGEFLGKGGFAKCYL----------
8635_Tthe_SAK                 IKRQS----Q--I-VQKKDDLKILNE-IEIIGDIQNIEQINKGGFGSIQKGKLAKILKYP
18358b_Tthe_PLK-Unclassified  -----------------------------------------KGGFAKCYE----------
18380_Tthe_PLK-Unclassified   -ANYP----TE-QKIIEEKTENKVT-GEKIIKKYSRGKLLGSGGFAKCYE----------
21183_Tthe_SAK                --------------V-EEEENHLMNSISTSLHNFKITLTLGRGAGSCVFL----------
22503_Tthe_PLK-Unclassified   -QAQP----QR-N-LLHEKRKN-QDGEWKVERSYEVLSKLGKGGFAKVYL----------
5034_Tthe_SAK                 --------------INEQERNSLFNSLSAQLSDYIISHPIGSGAGSLVVK----------
8829_Tthe_PLK-Unclassified    ------------LIIIEEK-ISKVN-GEMAVKKYLRGKLLGKGGFAKCYE----------
SAK_Spur_SAK                  ----------------------------DRIENYQVLNLLGRGGFACVYR----------
PLK1_Spur_PLK1                -------------LRVKEV-PDVVT-DPSTGKTYTKGRFLGKGGFAKCYE----------
PLK2_Spur_PLK2                -KAT-----PA-VSKLPEL-PAVIV-DPESGERYRRGRLLG-GGFARCYE----------
n1170_Tthe_PLK-Unclassified   -AASD----TE-PLIIEER-VQIVN-GEQIIKRYQRGSLLGKGGFAKCFQ----------
n808_Tthe_PLK-Unclassified    -AASD----TE-PLIIEER-VQIVN-GEQIIKRYQRGSLLGKGGFAKCFQ----------
CC1G_07437_Ccin_PLK1          -SSPPLPRQNS-KTRPPSP-PKVIS-DKAGRLQFNRVGFLGEGGFARVYE----------
AqueK200_Aque_PLK1            ----------A-SSLSKPL-KEFVT-NPDTKKRYEKGRFLGKGGFAKCYE----------
AqueK201_Aque_SAK             --------------------------------DYEVLNRLGKGSFADVYR----------
GK066_Glam_PLK-Unclassified   -----------------EL-HPQIV-DPFHNVTYRPGKLLGKGGFAYVYE----------
                                                                        *. .

PLK4_Hsap_SAK                 ------------------------------------------------------------
PLK3_Hsap_PLK2                ------------------------------------------------------------
PLK2_Hsap_PLK2                ------------------------------------------------------------
PLK1_Hsap_PLK1                ------------------------------------------------------------
polo_Dmel_PLK1                ------------------------------------------------------------
SAK_Dmel_SAK                  ------------------------------------------------------------
PLK5_Mmus_PLK2                ------------------------------------------------------------
PLK4_Mmus_SAK                 ------------------------------------------------------------
PLK3_Mmus_PLK2                ------------------------------------------------------------
PLK2_Mmus_PLK2                ------------------------------------------------------------
PLK1_Mmus_PLK1                ------------------------------------------------------------
plk-2_Cele_PLK1               ------------------------------------------------------------
plk-1_Cele_PLK1               ------------------------------------------------------------
F55G1.8_Cele_PLK1             ------------------------------------------------------------
CDC5_Scer_PLK1                ------------------------------------------------------------
zyg-1_Cele_SAK                ------------------------------------------------------------
PLK_Ddis_PLK1                 ------------------------------------------------------------
8635_Tthe_SAK                 LYGHFSQTMSLITKLYIMWQIAQGIQFLTSKNVAHLDLKPANIVISKGYLAKIIDFGEAY
18358b_Tthe_PLK-Unclassified  ------------------------------------------------------------
18380_Tthe_PLK-Unclassified   ------------------------------------------------------------
21183_Tthe_SAK                ------------------------------------------------------------
22503_Tthe_PLK-Unclassified   ------------------------------------------------------------
5034_Tthe_SAK                 ------------------------------------------------------------
8829_Tthe_PLK-Unclassified    ------------------------------------------------------------
SAK_Spur_SAK                  ------------------------------------------------------------
PLK1_Spur_PLK1                ------------------------------------------------------------
PLK2_Spur_PLK2                ------------------------------------------------------------
n1170_Tthe_PLK-Unclassified   ------------------------------------------------------------
n808_Tthe_PLK-Unclassified    ------------------------------------------------------------
CC1G_07437_Ccin_PLK1          ------------------------------------------------------------
AqueK200_Aque_PLK1            ------------------------------------------------------------
AqueK201_Aque_SAK             ------------------------------------------------------------
GK066_Glam_PLK-Unclassified   ------------------------------------------------------------


PLK4_Hsap_SAK                 ------------------------------------------------------------
PLK3_Hsap_PLK2                ------------------------------------------------------------
PLK2_Hsap_PLK2                ------------------------------------------------------------
PLK1_Hsap_PLK1                ------------------------------------------------------------
polo_Dmel_PLK1                ------------------------------------------------------------
SAK_Dmel_SAK                  ------------------------------------------------------------
PLK5_Mmus_PLK2                ------------------------------------------------------------
PLK4_Mmus_SAK                 ------------------------------------------------------------
PLK3_Mmus_PLK2                ------------------------------------------------------------
PLK2_Mmus_PLK2                ------------------------------------------------------------
PLK1_Mmus_PLK1                ------------------------------------------------------------
plk-2_Cele_PLK1               ------------------------------------------------------------
plk-1_Cele_PLK1               ------------------------------------------------------------
F55G1.8_Cele_PLK1             ------------------------------------------------------------
CDC5_Scer_PLK1                ------------------------------------------------------------
zyg-1_Cele_SAK                ------------------------------------------------------------
PLK_Ddis_PLK1                 ------------------------------------------------------------
8635_Tthe_SAK                 HPDVCNGKEFYNNQQRLIFKSYFLMKGNPNYKPGRTLPYTPYSNNNDRQASYKNLDIFSF
18358b_Tthe_PLK-Unclassified  ------------------------------------------------------------
18380_Tthe_PLK-Unclassified   ------------------------------------------------------------
21183_Tthe_SAK                ------------------------------------------------------------
22503_Tthe_PLK-Unclassified   ------------------------------------------------------------
5034_Tthe_SAK                 ------------------------------------------------------------
8829_Tthe_PLK-Unclassified    ------------------------------------------------------------
SAK_Spur_SAK                  ------------------------------------------------------------
PLK1_Spur_PLK1                ------------------------------------------------------------
PLK2_Spur_PLK2                ------------------------------------------------------------
n1170_Tthe_PLK-Unclassified   ------------------------------------------------------------
n808_Tthe_PLK-Unclassified    ------------------------------------------------------------
CC1G_07437_Ccin_PLK1          ------------------------------------------------------------
AqueK200_Aque_PLK1            ------------------------------------------------------------
AqueK201_Aque_SAK             ------------------------------------------------------------
GK066_Glam_PLK-Unclassified   ------------------------------------------------------------


PLK4_Hsap_SAK                 ------------------------------------------------------------
PLK3_Hsap_PLK2                ------------------------------------------------------------
PLK2_Hsap_PLK2                ------------------------------------------------------------
PLK1_Hsap_PLK1                ------------------------------------------------------------
polo_Dmel_PLK1                ------------------------------------------------------------
SAK_Dmel_SAK                  ------------------------------------------------------------
PLK5_Mmus_PLK2                ------------------------------------------------------------
PLK4_Mmus_SAK                 ------------------------------------------------------------
PLK3_Mmus_PLK2                ------------------------------------------------------------
PLK2_Mmus_PLK2                ------------------------------------------------------------
PLK1_Mmus_PLK1                ------------------------------------------------------------
plk-2_Cele_PLK1               ------------------------------------------------------------
plk-1_Cele_PLK1               ------------------------------------------------------------
F55G1.8_Cele_PLK1             ------------------------------------------------------------
CDC5_Scer_PLK1                ------------------------------------------------------------
zyg-1_Cele_SAK                ------------------------------------------------------------
PLK_Ddis_PLK1                 ------------------------------------------------------------
8635_Tthe_SAK                 GMVLSEIVFDTYPVDFKRGALHKLEEKFSRGDIRGRLVKNYQRHFGPKHIINLLHCLIFR
18358b_Tthe_PLK-Unclassified  ------------------------------------------------------------
18380_Tthe_PLK-Unclassified   ------------------------------------------------------------
21183_Tthe_SAK                ------------------------------------------------------------
22503_Tthe_PLK-Unclassified   ------------------------------------------------------------
5034_Tthe_SAK                 ------------------------------------------------------------
8829_Tthe_PLK-Unclassified    ------------------------------------------------------------
SAK_Spur_SAK                  ------------------------------------------------------------
PLK1_Spur_PLK1                ------------------------------------------------------------
PLK2_Spur_PLK2                ------------------------------------------------------------
n1170_Tthe_PLK-Unclassified   ------------------------------------------------------------
n808_Tthe_PLK-Unclassified    ------------------------------------------------------------
CC1G_07437_Ccin_PLK1          ------------------------------------------------------------
AqueK200_Aque_PLK1            ------------------------------------------------------------
AqueK201_Aque_SAK             ------------------------------------------------------------
GK066_Glam_PLK-Unclassified   ------------------------------------------------------------


PLK4_Hsap_SAK                 ------------------------------------------------------------
PLK3_Hsap_PLK2                ------------------------------------------------------------
PLK2_Hsap_PLK2                ------------------------------------------------------------
PLK1_Hsap_PLK1                ------------------------------------------------------------
polo_Dmel_PLK1                ------------------------------------------------------------
SAK_Dmel_SAK                  ------------------------------------------------------------
PLK5_Mmus_PLK2                ------------------------------------------------------------
PLK4_Mmus_SAK                 ------------------------------------------------------------
PLK3_Mmus_PLK2                ------------------------------------------------------------
PLK2_Mmus_PLK2                ------------------------------------------------------------
PLK1_Mmus_PLK1                ------------------------------------------------------------
plk-2_Cele_PLK1               ------------------------------------------------------------
plk-1_Cele_PLK1               ------------------------------------------------------------
F55G1.8_Cele_PLK1             ------------------------------------------------------------
CDC5_Scer_PLK1                ------------------------------------------------------------
zyg-1_Cele_SAK                ------------------------------------------------------------
PLK_Ddis_PLK1                 ------------------------------------------------------------
8635_Tthe_SAK                 CIDEKENRPTIDWIILISIYFKEVNKFYQQQICKHKKTFKATKRVLTKKESTEIYFERQI
18358b_Tthe_PLK-Unclassified  ------------------------------------------------------------
18380_Tthe_PLK-Unclassified   ------------------------------------------------------------
21183_Tthe_SAK                ------------------------------------------------------------
22503_Tthe_PLK-Unclassified   ------------------------------------------------------------
5034_Tthe_SAK                 ------------------------------------------------------------
8829_Tthe_PLK-Unclassified    ------------------------------------------------------------
SAK_Spur_SAK                  ------------------------------------------------------------
PLK1_Spur_PLK1                ------------------------------------------------------------
PLK2_Spur_PLK2                ------------------------------------------------------------
n1170_Tthe_PLK-Unclassified   ------------------------------------------------------------
n808_Tthe_PLK-Unclassified    ------------------------------------------------------------
CC1G_07437_Ccin_PLK1          ------------------------------------------------------------
AqueK200_Aque_PLK1            ------------------------------------------------------------
AqueK201_Aque_SAK             ------------------------------------------------------------
GK066_Glam_PLK-Unclassified   ------------------------------------------------------------


PLK4_Hsap_SAK                 ---------------------------------------AES------------------
PLK3_Hsap_PLK2                ---------------------------------------ATD------------------
PLK2_Hsap_PLK2                ---------------------------------------MTD------------------
PLK1_Hsap_PLK1                ---------------------------------------ISD------------------
polo_Dmel_PLK1                ---------------------------------------IID------------------
SAK_Dmel_SAK                  ---------------------------------------ARC------------------
PLK5_Mmus_PLK2                ---------------------------------------LTD------------------
PLK4_Mmus_SAK                 ---------------------------------------AES------------------
PLK3_Mmus_PLK2                ---------------------------------------ATD------------------
PLK2_Mmus_PLK2                ---------------------------------------MTD------------------
PLK1_Mmus_PLK1                ---------------------------------------ISD------------------
plk-2_Cele_PLK1               ---------------------------------------LRN------------------
plk-1_Cele_PLK1               ---------------------------------------LTN------------------
F55G1.8_Cele_PLK1             ---------------------------------------FRK------------------
CDC5_Scer_PLK1                ---------------------------------------IKD------------------
zyg-1_Cele_SAK                ---------------------------------------AQR------------------
PLK_Ddis_PLK1                 ---------------------------------------MTE------------------
8635_Tthe_SAK                 KQFLYPLMIYTQVSDELSFKDIEASLDYDIKGANGFVCKIEDFKSKECYNSNEAKKYYVY
18358b_Tthe_PLK-Unclassified  ---------------------------------------FTN------------------
18380_Tthe_PLK-Unclassified   ---------------------------------------VIA------------------
21183_Tthe_SAK                ---------------------------------------IEE------------------
22503_Tthe_PLK-Unclassified   ---------------------------------------AKD------------------
5034_Tthe_SAK                 ---------------------------------------VKS------------------
8829_Tthe_PLK-Unclassified    ---------------------------------------VTN------------------
SAK_Spur_SAK                  ---------------------------------------AKT------------------
PLK1_Spur_PLK1                ---------------------------------------LTD------------------
PLK2_Spur_PLK2                ---------------------------------------LTH------------------
n1170_Tthe_PLK-Unclassified   ---------------------------------------VTN------------------
n808_Tthe_PLK-Unclassified    ---------------------------------------VTN------------------
CC1G_07437_Ccin_PLK1          ---------------------------------------VQD------------------
AqueK200_Aque_PLK1            ---------------------------------------LIC------------------
AqueK201_Aque_SAK             ---------------------------------------AKC------------------
GK066_Glam_PLK-Unclassified   ---------------------------------------FHD------------------


PLK4_Hsap_SAK                 --IHT--GLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKH-PSILELYNYFEDSNYVY
PLK3_Hsap_PLK2                --TET--GSAYAVKVIPQSRVAKPHQREKILNEIELHRDLQH-RHIVRFSHHFEDADNIY
PLK2_Hsap_PLK2                --LTN--NKVYAAKIIPHSRVAKPHQREKIDKEIELHRILHH-KHVVQFYHYFEDKENIY
PLK1_Hsap_PLK1                --ADT--KEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAH-QHVVGFHGFFEDNDFVF
polo_Dmel_PLK1                --VET--DDVFAGKIVSKKLMIKHNQKEKTAQEITIHRSLNH-PNIVKFHNYFEDSQNIY
SAK_Dmel_SAK                  --LHT--HQDVAIKMIDKKLIQGTGLTNRVRQEVEIHSRLKH-PSVLQLYTFFQDANYVY
PLK5_Mmus_PLK2                --MST--SAVFALKVVPRGGAGRLRLRGKVEREIALHSRLRH-RNIVAFHAHFADRDHVY
PLK4_Mmus_SAK                 --IHT--GLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKH-PSVLELYNYFEDNNYVY
PLK3_Mmus_PLK2                --TES--GIAYAVKVIPQSRVAKPHQREKILNEIELHRDLQH-RHIVRFSHHFEDADNIY
PLK2_Mmus_PLK2                --LTN--NKVYAAKIIPHSRVAKPHQREKIDKEIELHRLLHH-KHVVQFYHYFEDKENIY
PLK1_Mmus_PLK1                --ADT--KEVFAGKIVPKSLLLKPHQKEKMSMEISIHRSLAH-QHVVGFHDFFEDSDFVF
plk-2_Cele_PLK1               --KST--GELFAGKVVPKALLIKQYQRDKMAQEVQIHRNLQH-RNVVKLYHFFEDKSNVY
plk-1_Cele_PLK1               --RAT--REVVAGKVVPKSMLVKQYQRDKMTQEVQIHRELGH-INIVKLFNFFEDNLNVY
F55G1.8_Cele_PLK1             --LDC--NDRLAVKVVPKVILLKSTAREKLTREVEIHRQLSH-RNIVQFHHFFEDSQNVY
CDC5_Scer_PLK1                ---DS--GEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSH-PNIVQFIDCFEDDSNVY
zyg-1_Cele_SAK                ---EN--GEKVAIKRIDKK-----VPKNRVWTEIQTMKELKKSKYVVEFYEDFVEDGYTY
PLK_Ddis_PLK1                 --VET--NRIYAAKIIPKSTLQKTRARSKLKSEIKIHSSLSH-ENIVKFEHCFENEENVY
8635_Tthe_SAK                 LLLTY--TKQKAMKVVDKKRKDIQNVMKRLDQEIKIQKELDH-PNIIKLFKHFEDDQNHY
18358b_Tthe_PLK-Unclassified  --LER--KQVLAAKVIPKSSLTKSRARQKLMSEIRIHKSLNH-RNIVKFQHFFEDQENVY
18380_Tthe_PLK-Unclassified   --LDTDPKAIFAAKIIPKSTLTKSRQRVKLISEIKIHKSLHH-KNIVQFEHVFEDHDNVY
21183_Tthe_SAK                --YKS--G------------------------SLYLHSQLDH-PNIVKILKRFEDNEYVY
22503_Tthe_PLK-Unclassified   --ISS--NEQYAIKVVDKSSLEKDSFKEKLNQEIKIQKSLNH-ENVVKYYTSFEDSQNVY
5034_Tthe_SAK                 --IKT--KKEYAIKVVDKQSQYYKSAYKRLKNEIEIHLDLKH-KNIVKMIKSFEDSENLY
8829_Tthe_PLK-Unclassified    --LET--KKIIAAKIIPKQTLTKNRARQKLISEIKIHKSLNH-QHVVAFEHVFEDHENVY
SAK_Spur_SAK                  --IST--GQEVAIKMIDKKLMQSSGMATRVKNEVEIHCQLKH-PSILELYSYFEDNNYVY
PLK1_Spur_PLK1                --DAT--KQIFAGKVVSKALLVKPHQKDKMTMEIHIHKSLHH-RHVVGFHSFFEDKENVY
PLK2_Spur_PLK2                --LDT--HYVYAGKIVPKERISKPSQREKMEREIAVHAQLRH-PHIVGFHKHFQDAENIY
n1170_Tthe_PLK-Unclassified   --LEN--KKVMAAKIIPKSTLVKNRARQKLISEIKIHKSLHH-NNIVKFEHVFEDHDNVY
n808_Tthe_PLK-Unclassified    --LEN--KKVMAAKIIPKSTLVKNRARQKLISEIKIHKSLHH-NNIVKFEHVFEDHDNVY
CC1G_07437_Ccin_PLK1          --PR---GSRLACKVVTKSALKTKKAKTKLYAEIKIHRSLDH-PNIVTFIDCFEDEDNVY
AqueK200_Aque_PLK1            --EET--GTVYAGKIVAKELLVKPHQKEKMTQEIEIHRSLSH-KHVVGFHGFFDDSNNVY
AqueK201_Aque_SAK             --KRT--KKEVAIKMIDKKLMVKKGMTERVKNEVKIHSHLKH-PSILELYDFFEDSNYVY
GK066_Glam_PLK-Unclassified   --VNS--DSSYACKITPRSALQKKKYYDKFVTEVTIHRGLVH-PNICRVLNVFKDQMNYY
                                                              .:     : :   :      * :    :

PLK4_Hsap_SAK                 LVLEMCHNG----EMNRYL-------KNRVKPFSENEARHFMHQIITGMLYLHSHGILHR
PLK3_Hsap_PLK2                IFLELCSRK----SLAHIW-------KAR-HTLLEPEVRYYLRQILSGLKYLHQRGILHR
PLK2_Hsap_PLK2                ILLEYCSRR----SMAHIL-------KAR-KVLTEPEVRYYLRQIVSGLKYLHEQEILHR
PLK1_Hsap_PLK1                VVLELCRRR----SLLELH-------KRR-KALTEPEARYYLRQIVLGCQYLHRNRVIHR
polo_Dmel_PLK1                IVLELCKKR----SMMELH-------KRR-KSITEFECRYYIYQIIQGVKYLHDNRIIHR
SAK_Dmel_SAK                  LVLELAHNG----ELHRYM-------NHIARPFTETEAASILKQVVAGLLYLHSHNIMHR
PLK5_Mmus_PLK2                MVLEYCSRQVPLQSLAHVL-------KVR-RTLTEPEVRYYLRGLVSGLRYLHQQRIVHR
PLK4_Mmus_SAK                 LVLEMCHNG----EMNRYL-------KNRMKPFSEREARHFMHQIITGMLYLHSHGILHR
PLK3_Mmus_PLK2                IFLELCSRK----SLAHIW-------KAR-HTLLEPEVRYYLRQILSGLKYLHQRGILHR
PLK2_Mmus_PLK2                ILLEYCSRR----SMAHIL-------KAR-KVLTEPEVRYYLRQIVSGLKYLHEQEILHR
PLK1_Mmus_PLK1                VVLELCRRR----SLLELH-------KRR-KALTEPEARYYLRQIVLGCQYLHRNQVIHR
plk-2_Cele_PLK1               ITLELCPRR----SLMELH-------KRR-KAVTEPEARYFTYQIVEGVLYLHNLKIVHR
plk-1_Cele_PLK1               ITLELCARR----SLMELH-------KRR-KAVTEPEARYFTHQIVDGVLYLHDLNIIHR
F55G1.8_Cele_PLK1             FTLELCSKN----SLMELN-------KQR-GPLTEHEARFYTIQVAEGVKHLHNLQIIHR
CDC5_Scer_PLK1                ILLEICPNG----SLMELL-------KRR-KVLTEPEVRFFTTQICGAIKYMHSRRVIHR
zyg-1_Cele_SAK                IVMELCEGG----SLQAYV-------REH-GALDDATAVHVLRQLISAVSFMHRVNVIHR
PLK_Ddis_PLK1                 ILLELCNQK----TVMDIH-------KKR-KYLMEYETKYYVYQVIMAVQYLHNNNIIHR
8635_Tthe_SAK                 LIMELAQNG----EIKDYL-------NIN-K----------PYQLACGIKYLHDKDIVHR
18358b_Tthe_PLK-Unclassified  ILLEMCTNQ----TMNELI-------RRR-KRLTELEVQCYLLQILYSIKYLHDNRVIHR
18380_Tthe_PLK-Unclassified   ILLELCPYQ----TLNELI-------KRR-KRITEYETQIYVMQIVNALKYLHQNKIIHR
21183_Tthe_SAK                MMLEYCPGG----SLFDYIVYINFQLFEK-TRLNEDEARDISYQIVQGLEYLHKNKIIHR
22503_Tthe_PLK-Unclassified   IVLEYCSNQ----EL---L-------DRR-KRLTEIEVKSHLFQIIQSLKYIHSKGVIHR
5034_Tthe_SAK                 LVMEYCEGG----DLFHYL-------KHH-KKLSETEAKRITYKLAEGLKYLHDKSIIHR
8829_Tthe_PLK-Unclassified    ILLELCTNH----TLNELI-------KRR-KRLTELEVQCYVVQIVNALKYLHSHKVIHR
SAK_Spur_SAK                  LVLELAQNG----ELLRYL-------KKKARVFGEEEARQFLEEIVIGLLYLHSHGILHR
PLK1_Spur_PLK1                VLLELCRRR----SLMELH-------KRR-KAITEPETRYFMRQCILACQYLSKTKVIHR
PLK2_Spur_PLK2                ILLELCRHK----SLLHML-------KLR-KHLTEPEVRYFMLQIIEGVRYLHSHCVIHR
n1170_Tthe_PLK-Unclassified   ILLELCPHQ----TLNELI-------KRR-KRITELETLCYTVQIVQALKYLHQNRVIHR
n808_Tthe_PLK-Unclassified    ILLELCPHQ----TLNELI-------KRR-KRITELETLCYTVQIVQALKYLHQNRVIHR
CC1G_07437_Ccin_PLK1          ITLELCPSG----SLMDML-------RRR-RRFTEPETRFFMVQLIGACHYMHTHQVIHR
AqueK200_Aque_PLK1            ILLELCKRR----SLMELH-------KRR-KALTEPEVRYLFRQTVLAVDYLHDVKVIHR
AqueK201_Aque_SAK             LILEFCQNG----ELNRYL-------KHRQKSLSE-DERIILNQVVKGLIYLHSFNIVHR
GK066_Glam_PLK-Unclassified   IILEKCNGG----TLTDLI-------RRR-KHLTETEARFFSKRILNALWYLHDLYIIHR
                              . :* .        :                                .  .:    ::**

PLK4_Hsap_SAK                 DLTLSNLLLTR----NMNIKIADFGLATQLKMPHEKHYTLCGTPNYISPEI---------
PLK3_Hsap_PLK2                DLKLGNFFITE----NMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEV---------
PLK2_Hsap_PLK2                DLKLGNFFINE----AMELKVGDFGLAARLEPLEHRRRTICGTPNYLSPEV---------
PLK1_Hsap_PLK1                DLKLGNLFLNE----DLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEV---------
polo_Dmel_PLK1                DLKLGNLFLND----LLHVKIGDFGLATRIEYEGERKKTLCGTPNYIAPEI---------
SAK_Dmel_SAK                  DISLSNLLLSR----EMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEV---------
PLK5_Mmus_PLK2                DLKPSNFFLNK----NMEVKIGDLGLAARVGPAGRCHRVLCGTPNFQAPEV---------
PLK4_Mmus_SAK                 DLTLSNILLTR----NMNIKIADFGLATQLNMPHEKHYTLCGTPNYISPEI---------
PLK3_Mmus_PLK2                DLKLGNFFITD----NMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEV---------
PLK2_Mmus_PLK2                DLKLGNFFINE----AMELKVGDFGLAARLEPLEHRRRTICGTPNYLSPEV---------
PLK1_Mmus_PLK1                DLKLGNLFLNE----DLEVKIGDFGLATKVEYEGERKKTLCGTPNYIAPEV---------
plk-2_Cele_PLK1               DLKLGNLFLND----ELQVKIGDFGLATTCDN-DERKKTLCGTPNYIAPEV---------
plk-1_Cele_PLK1               DMKLGNLFLND----DLVVKIGDFGLATTVNG-DERKKTLCGTPNYIAPEV---------
F55G1.8_Cele_PLK1             DLKLGNLFLNE----HLQVKIGDFGLATFCEK-NEKKMTRGGTPNYIAPEV---------
CDC5_Scer_PLK1                DLKLGNIFFDS----NYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEV---------
zyg-1_Cele_SAK                DLSAGNVFIKDSKKKKMTVKLGDFGLATTLGR-GETTCTIVGTPGFIAPQV---------
PLK_Ddis_PLK1                 DLKLGNLFI-D----NMRIKLGDFGLSTKVEH-GERKKTICGTPNYIAPEI---------
8635_Tthe_SAK                 DLKLNNVLLS-----NGKIKIADFGLATKVNDENPECNTMCGTANYLSPEI---------
18358b_Tthe_PLK-Unclassified  DLKLGNLFLSD----KMEIKLGDFGLATKLEYDGERKRTICGTPNYIAPEI---------
18380_Tthe_PLK-Unclassified   DLKLGNLFLGD----NMTLKIGDFGLATKIEYEGEKKKTVCGTPNYIAPEI---------
21183_Tthe_SAK                DLKPGNILLTG----NNSVKICDFGLAVRVTNYESERDTFCGTPNYIAPEK---------
22503_Tthe_PLK-Unclassified   DLKIANIFLND----KMVVKLADFGLSAMMKN-AQKRKTVCGTPNYIAPEV---------
5034_Tthe_SAK                 DLKLGNVLLSS----DHQVKICDFGLAVRLNGNEQEKNTICGTPNYISPEI---------
8829_Tthe_PLK-Unclassified    DLKLGNLFLNE----KMEIKLGDFGLATKLEFDGEKKHTICGTPNYIAPEI---------
SAK_Spur_SAK                  DLTLANILLTR----DMHCKIADFGLAAQLKLPEEQHYTMCGTPNYISPEI---------
PLK1_Spur_PLK1                DLKLGNLFIDD----NMELKVGDFGLATKVDFSGERKKTLCGTPNYIAPEV---------
PLK2_Spur_PLK2                DLKLGNMFLTD----TMGVKIGDFGLAAKLEFEGDRKRTMCGTPNYIAPEV---------
n1170_Tthe_PLK-Unclassified   DLKLGNLFVGE----KMEIKLGDFGLATKLEFDGEKKRTICGTPNYIAPEI---------
n808_Tthe_PLK-Unclassified    DLKLGNLFVGE----KMEIKLGDFGLATKLEFDGEKKRTICGTPNYIAPEI---------
CC1G_07437_Ccin_PLK1          DLKLGNLFLDA----NMNVKVGDFGLAALIENPGERKKTICGTPNYIAPEV---------
AqueK200_Aque_PLK1            DLKLGNLFLND----DIEIKLGDFGLATRLEEDGERKKTLCGTPNYIAPEV---------
AqueK201_Aque_SAK             DLSLSNILLTS----SMDIKIADFGLSVTLDLPGDKHHTLCGTPNYIAPYVICCYEGCFL
GK066_Glam_PLK-Unclassified   DIKTSNIFLME----DFDVKVGDFGLAVKCETPEELHWTMCGTPNFLPSEV---------
                              *:.  *.:.          *: *:**:.          .  **..: ..

PLK4_Hsap_SAK                 --------AT---------------------------------RSAHGLESDVWSLGCMF
PLK3_Hsap_PLK2                --------LL---------------------------------RQGHGPEADVWSLGCVM
PLK2_Hsap_PLK2                --------LN---------------------------------KQGHGCESDIWALGCVM
PLK1_Hsap_PLK1                --------LS---------------------------------KKGHSFEVDVWSIGCIM
polo_Dmel_PLK1                --------LT---------------------------------KKGHSFEVDIWSIGCVM
SAK_Dmel_SAK                  --------VS---------------------------------RTSHGLPADVWSVGCML
PLK5_Mmus_PLK2                --------VS---------------------------------RNGHSCKSDIWALGCIM
PLK4_Mmus_SAK                 --------AT---------------------------------RSAHGLESDIWSLGCMF
PLK3_Mmus_PLK2                --------LL---------------------------------RQGHGPEADVWSLGCVM
PLK2_Mmus_PLK2                --------LN---------------------------------KQGHGCESDIWALGCVM
PLK1_Mmus_PLK1                --------LS---------------------------------KKGHSFEVDVWSIGCIM
plk-2_Cele_PLK1               --------LN---------------------------------KIGHSFEVDLWAIGCIL
plk-1_Cele_PLK1               --------LN---------------------------------KAGHSFEVDIWAVGCIL
F55G1.8_Cele_PLK1             --------LN---------------------------------ETGHAFEVDIWAIGCIL
CDC5_Scer_PLK1                --------LMG-------------------------------KHSGHSFEVDIWSLGVML
zyg-1_Cele_SAK                --------YD---------------------------------Q-EYTQSADVYSLGAVL
PLK_Ddis_PLK1                 --------LD--------------------------------NSNGHSYEVDVWSIGIIL
8635_Tthe_SAK                 --------LN---------------------------------SKGYGKKTDIWSFGCIL
18358b_Tthe_PLK-Unclassified  --------LEA-------------------------------KETGHSYEVDVWSFGVIA
18380_Tthe_PLK-Unclassified   --------LE--------------------------------GKDGHSYEVDMWSLGVII
21183_Tthe_SAK                ----------------------------------------------YGIQSDCWSFGCIL
22503_Tthe_PLK-Unclassified   --------LK---------------------------------NQGHDYLVDNWAIGVIV
5034_Tthe_SAK                 --------LN---------------------------------KQPYGMKIDCWSFGCIL
8829_Tthe_PLK-Unclassified    --------LD--------------------------------GKTGHSYQVDIWSLGVII
SAK_Spur_SAK                  --------AT---------------------------------RGPHGLQSDVWSLGCML
PLK1_Spur_PLK1                --------LS---------------------------------KKGHSYEVDLWSLGCIM
PLK2_Spur_PLK2                --------LG---------------------------------KIGHSFEADVWALGCIM
n1170_Tthe_PLK-Unclassified   --------LD--------------------------------GRVGHSYEVDIWSLGVIL
n808_Tthe_PLK-Unclassified    --------LD--------------------------------GRVGHSYEVDIWSLGVIL
CC1G_07437_Ccin_PLK1          --------LFD-------------------------------TANGHSFEVDIWSIGVIL
AqueK200_Aque_PLK1            --------LT---------------------------------KKGHSYEVDIWSLGCIL
AqueK201_Aque_SAK             IFIFCREVAK---------------------------------REAHGLESDIWSLGCMV
GK066_Glam_PLK-Unclassified   --------IYSHIMKRKASGRGPDPNLDEDCVNLCHQLLPAYSGQGHSFSADMWSFGCLV
                                                                            :    * ::.* :

PLK4_Hsap_SAK                 YTLLIGRPPFDTDTVKNTLNKVV-LAD--YEMPS--FLSIEAKDLIHQLLRRNPADRLSL
PLK3_Hsap_PLK2                YTLLCGSPPFETADLKETYRCIK-QVH--YTLPAS--LSLPARQLLAAILRASPRDRPSI
PLK2_Hsap_PLK2                YTMLLGRPPFETTNLKETYRCIR-EAR--YTMPSS--LLAPAKHLIASMLSKNPEDRPSL
PLK1_Hsap_PLK1                YTLLVGKPPFETSCLKETYLRIK-KNE--YSIPKH--INPVAASLIQKMLQTDPTARPTI
polo_Dmel_PLK1                YTLLVGQPPFETKTLKDTYSKIK-KCE--YRVPSY--LRKPAADMVIAMLQPNPESRPAI
SAK_Dmel_SAK                  YTLLVGRPPFETDAVQSTLNKVV-MSE--YIMPA--HLSYEAQDLINKLLKKLPHERITL
PLK5_Mmus_PLK2                YTVLTGTPPFAAAPLSEMYQNIR-DGH--YLEPTH--LSPSARSLIARLLAPDPAERPSL
PLK4_Mmus_SAK                 YTLLIGRPPFDTDTVKNTLNKVV-LAD--YEMPA--FLSREAQDLIHQLLRRNPADRLSL
PLK3_Mmus_PLK2                YTLLCGSPPFETADLKETYRCIK-QVH--YTLPAS--LSLPARQLLAAILRASPRDRPSI
PLK2_Mmus_PLK2                YTMLLGRPPFETTNLKETYRCIR-EAR--YTMPSS--LLAPAKHLIASMLSKNPEDRPSL
PLK1_Mmus_PLK1                YTLLVGKPPFETSCLKETYLRIK-KNE--YSIPKH--INPVAASLIQKMLQTDPTARPTI
plk-2_Cele_PLK1               YILLFGHPPFESKSLEETYSRIK-NNN--YVIPTS--ASAAASQLIRVLLDPVPSRRPNA
plk-1_Cele_PLK1               YILLFGQPPFESKSLEETYSRIR-HNN--YTIPSI--ATQPAASLIRKMLDPEPTRRPTA
F55G1.8_Cele_PLK1             YVLLFGSPPFESRRVQETYVRIK-NND--YVVPE--NASPTANRLIRSLLDPVPDRRPTA
CDC5_Scer_PLK1                YALLIGKPPFQARDVNTIYERIK-CRD--FSFPRDKPISDEGKILIRDILSLDPIERPSL
zyg-1_Cele_SAK                YTMLTARNPPPK------------------GLPPTCGMSPNAARLVEQMMDTDAKKRIPL
PLK_Ddis_PLK1                 YTLLIGKPPFETSDVKHTYQRIK-QNQ--YSFPDEPIISHYGKSLIISILNPVPEQRPNL
8635_Tthe_SAK                 YALCSGNLPFFSGNPSQTIQNIK-EGK--WQLPQN--ISDNVKDLLSNTLNWDQNSRFSI
18358b_Tthe_PLK-Unclassified  YTLLIGKPPFETNDVKSTYKKIR-TNE--YSFPEQIQISSAAKNMIKKILTTDPSKRPTI
18380_Tthe_PLK-Unclassified   YTLLIGKPPFETKDVRTTYKRIK-MNN--YCFPEQIQISDNAKSIITSILNLNPQKRLTL
21183_Tthe_SAK                YTIATGRPPFETVSIQQTLKMLQKKNK--VEYPSH--LSKSLVDLIDHILDWNQDTRYNI
22503_Tthe_PLK-Unclassified   YTFLIGKPPFEEKEVENTLRNIK-ANR--YSFPENCTISKEAKDFIQKILVPNPDQRLTM
5034_Tthe_SAK                 YALIVGHPPFQGQDIVQTLKKVT-SQEQFFELPNN--ISDNLKDLLVNIINWNQDSRFTI
8829_Tthe_PLK-Unclassified    YTLLIGKPPFETPDVKTTYKKIR-NIS--YGFPENVPISDQARGLITRILNIDPQRRPTL
SAK_Spur_SAK                  YTFLTGTPPFDTEAVKTTLNKVM-LAE--YIIPT--HISMEAKDLINKMLRKDPTERIGL
PLK1_Spur_PLK1                YTLLVGKPPFETQSLKDTYQRIK-RNE--YRVPSH--VSTPARNLIVKLLKNDPTQRPHI
PLK2_Spur_PLK2                YTMLVGRPPFETSSLKETYARIK-HNK--YHFPET--LSPVAKEIISDLLSSDPEERPPL
n1170_Tthe_PLK-Unclassified   YTLLIGKPPFETHDVKTTYRKIK-SNQ--YSFPDHAPIPDSAKALIQLILQQDPAKRPTL
n808_Tthe_PLK-Unclassified    YTLLIGKNNCIQL----SFRRSR-K-Q--YSR----------------------------
CC1G_07437_Ccin_PLK1          YTLVIGRPPFQTKEVKEIYKRIR-DNE--YEFPAERAISTAVKVLIQQILTPDPSQRPTL
AqueK200_Aque_PLK1            YTLLVGKPPFETKTLKDTYQRIK-RNE--YHIPHY--VGPEARTLISNLLRPNPANRPTA
AqueK201_Aque_SAK             YTMLVGTPPFDTDDVQSTLDNVV-NGD--FDIPQ--YITTNCTSLNL--HVYHPSKRLTL
GK066_Glam_PLK-Unclassified   FSMIYGRPPFEAADIKTTYKRIV-RCD--FSFPGSISVSEDLKNFIKGLLTPDPRKRFTV
                              : .  .

PLK4_Hsap_SAK                 SSVLDHPFMSRN--SSTK-----SKDLGT--V----------------------------
PLK3_Hsap_PLK2                DQILRHDFFTKG--YTPD-----RLPISS--C----------------------------
PLK2_Hsap_PLK2                DDIIRHDFFLQG--FTPD-----RLSSSC--C----------------------------
PLK1_Hsap_PLK1                NELLNDEFFTSG--YIPA-----RLPITC--L----------------------------
polo_Dmel_PLK1                GQLLNFEFLKGS--KVPM-----FLPSSC--L----------------------------
SAK_Dmel_SAK                  EAVLCHPFMLKC--SNGGHSAPGALNVFS--Q----------------------------
PLK5_Mmus_PLK2                DHLLQDDFFSQG--FTPE-----RLPPHS--C----------------------------
PLK4_Mmus_SAK                 SSVLDHPFMSRN--PSPK-----SKDVGT--V----------------------------
PLK3_Mmus_PLK2                EQILRHDFFTKG--YTPD-----RLPVSS--C----------------------------
PLK2_Mmus_PLK2                DDIIRHDFFLQG--FTPD-----RLSSSC--C----------------------------
PLK1_Mmus_PLK1                HELLNDEFFTSG--YIPA-----RLPITC--L----------------------------
plk-2_Cele_PLK1               RAVCRDHFFKSG--FMPA-----RLPVSC--L----------------------------
plk-1_Cele_PLK1               KQVQRDGFFKSG--FMPT-----RLPVSC--L----------------------------
F55G1.8_Cele_PLK1             EAVLLDQFFKTT--IEPT-----YPPVHQ--Q----------------------------
CDC5_Scer_PLK1                TEIMDYVWFRGT---FPP-----SIPSTV--M----------------------------
zyg-1_Cele_SAK                TQIVLSEFMYEN--TNEN-----AVIFSR-------------------------------
PLK_Ddis_PLK1                 TQILEHDFFTYS--PIPK-----YLPVSS--L----------------------------
8635_Tthe_SAK                 EQVLSHKFYEKKH--KQS-----IIIFNQ--GADAISNQ---------------------
18358b_Tthe_PLK-Unclassified  NELFNDDFFKTG-GSIPK-----LLPVST--L----------------------------
18380_Tthe_PLK-Unclassified   DELLEHPFMQGT-ALNPE-----NLPISS--L----------------------------
21183_Tthe_SAK                SQIKSHPFYNKSK--QNT-----HENEYK--L----------------------------
22503_Tthe_PLK-Unclassified   DQMLQHPFMKSEEYYIPK-----TFPIST--L----------------------------
5034_Tthe_SAK                 DQILMHPFYEEMR--QKS-----VKQRQE--EEESLSFFNSIRSVKGEDQRINVHQNGVK
8829_Tthe_PLK-Unclassified    DEIMSSSFLNTG-GTIPK-----VLPLAT--L----------------------------
SAK_Spur_SAK                  STVLDHPFMDKT--RFNGTK---NRPLSKRPV----------------------------
PLK1_Spur_PLK1                DILLQDEFFTTG--YLPP-----QLPTTC--L----------------------------
PLK2_Spur_PLK2                EVVIDHEFFTQG--FVPE-----TLSPTA--C----------------------------
n1170_Tthe_PLK-Unclassified   DEILAHPFINNG-GTIPR-----LLPVST--L----------------------------
n808_Tthe_PLK-Unclassified    ---LAWPYFNK-------------------------------------------------
CC1G_07437_Ccin_PLK1          HEIIEDTFFTHG--TVPA-----FIPTSA--H----------------------------
AqueK200_Aque_PLK1            AEILKDPFFTCG--HMPV-----RLPVSC--L----------------------------
AqueK201_Aque_SAK             QQVLYHSFTKGV--QQE-----NVLQKRT--L----------------------------
GK066_Glam_PLK-Unclassified   KECLDHSWLNPSKYFIPE-----SLPPRI--I----------------------------
                                     :

PLK4_Hsap_SAK                 -------------------EDS-----------IDSGHATISTAITASSSTSIS------
PLK3_Hsap_PLK2                -------------------VTV-----------PDLTPP------NPA--RS--------
PLK2_Hsap_PLK2                -------------------HTV-----------PDFHLS------SPA--KN--------
PLK1_Hsap_PLK1                -------------------TIP-----------PRFSIA------PSS--LD--------
polo_Dmel_PLK1                -------------------TMA-----------PRIGSN------DTI--ED--------
SAK_Dmel_SAK                  -------------------S-------------MESGDSGIITFASSDSRNSQQ------
PLK5_Mmus_PLK2                -------------------HSP-----------PVFAFP------PPL--GR--------
PLK4_Mmus_SAK                 -------------------EDS-----------MDSGHATLSTTITASSGTSLS------
PLK3_Mmus_PLK2                -------------------VTV-----------PDLTPP------NPA--RS--------
PLK2_Mmus_PLK2                -------------------HTV-----------PDFHLS------SPA--KN--------
PLK1_Mmus_PLK1                -------------------TIP-----------PRFSIA------PSS--LD--------
plk-2_Cele_PLK1               -------------------TMV-----------PHLNDD------EY----A--------
plk-1_Cele_PLK1               -------------------TMV-----------PKFGGH------ETS--MM--------
F55G1.8_Cele_PLK1             -------------------L-------------------------HKE--QD--------
CDC5_Scer_PLK1                -------------------SEA-----------PNFEDI------PEE--QS--------
zyg-1_Cele_SAK                -------------------E-------------------------HSR--DGRR------
PLK_Ddis_PLK1                 -------------------TTA-----------PSQSTI------NQN--MG--------
8635_Tthe_SAK                 ---------------QNKLSTP--NKVLLDWTSPRFNAP---IHLQQK--SQ-SSQ----
18358b_Tthe_PLK-Unclassified  -------------------ACP-----------PSASYT------RQF--LP--------
18380_Tthe_PLK-Unclassified   -------------------VVP-----------FQKPKK------EAL--KE--------
21183_Tthe_SAK                -------------------QNP--MTF----APPQPFQM------EQS--VN--------
22503_Tthe_PLK-Unclassified   -------------------ALP-----------PTANYL------RKL--RK--------
5034_Tthe_SAK                 KIDIKYQDNFFNQLEHKEGSMP--KKS----NSP--TNI------HER--KN---QMIYK
8829_Tthe_PLK-Unclassified    -------------------ACP-----------PSASYT------KQF--LP--------
SAK_Spur_SAK                  -------------------ESS-----------LDSGLATMATISS--SHTSNR------
PLK1_Spur_PLK1                -------------------TMA-----------PRFQVP------VSS------------
PLK2_Spur_PLK2                -------------------VTA-----------PDFPIT------KVL--IS--------
n1170_Tthe_PLK-Unclassified   -------------------TTA-----------PNTSYI------KQY--AP--------
n808_Tthe_PLK-Unclassified    ------------------------------------------------------------
CC1G_07437_Ccin_PLK1          -------------------DAA-----------PDFRHI------SRS--AS--------
AqueK200_Aque_PLK1            -------------------TTT-----------PHFKKA------AES--A---------
AqueK201_Aque_SAK             -------------------SL------------------------TTP------------
GK066_Glam_PLK-Unclassified   -------------------SEPYEV--------PPLCSA------SPT--RN--------


PLK4_Hsap_SAK                 ---------------------------------GS---L------FDKR-----------
PLK3_Hsap_PLK2                ---------------------------------L--FA----------------------
PLK2_Hsap_PLK2                ---------------------------------F--FK----------------------
PLK1_Hsap_PLK1                ---------------------------------PS-NR----------------------
polo_Dmel_PLK1                ---------------------------------SM-HR----------------------
SAK_Dmel_SAK                  ---------------------------------I--------------R-----------
PLK5_Mmus_PLK2                ---------------------------------L--FR----------------------
PLK4_Mmus_SAK                 ---------------------------------GS---L------LD-R-----------
PLK3_Mmus_PLK2                ---------------------------------L--FA----------------------
PLK2_Mmus_PLK2                ---------------------------------F--FK----------------------
PLK1_Mmus_PLK1                ---------------------------------PS-SR----------------------
plk-2_Cele_PLK1               ---------------------------------EE-NV----------------------
plk-1_Cele_PLK1               ---------------------------------EE-NV----------------------
F55G1.8_Cele_PLK1             ---------------------------------VK---Y------F--------------
CDC5_Scer_PLK1                ---------------------------------LV---N------F--------------
zyg-1_Cele_SAK                ---------------------------------QR---S------R--------------
PLK_Ddis_PLK1                 ---------------------------------RPLSEK------T--------------
8635_Tthe_SAK                 ---------------------------------KK---N---------------------
18358b_Tthe_PLK-Unclassified  ---------------------------------ST---Q------I--------------
18380_Tthe_PLK-Unclassified   ---------------------------------KS---N------N--------------
21183_Tthe_SAK                ---------------------------------QN---N---------------------
22503_Tthe_PLK-Unclassified   ---------------------------------SE---S---------------------
5034_Tthe_SAK                 NDQIAALKNNKIQNEDLNIMSNNLNQIQYKKQSQN---NLVKQNDK--------------
8829_Tthe_PLK-Unclassified    ---------------------------------QG---N------A--------------
SAK_Spur_SAK                  ---------------------------------TS-----------SRS-----------
PLK1_Spur_PLK1                ------------------------------------GR----------------------
PLK2_Spur_PLK2                ---------------------------------DR-KG----------DLVTNEFCRLKR
n1170_Tthe_PLK-Unclassified   ---------------------------------SA---S------N--------------
n808_Tthe_PLK-Unclassified    ------------------------------------------------------------
CC1G_07437_Ccin_PLK1          ---------------------------------EANLKR---LRRY--ALLDTDFNN--T
AqueK200_Aque_PLK1            ---------------------------------VS-GR----------------------
AqueK201_Aque_SAK             ------------------------------------------------------------
GK066_Glam_PLK-Unclassified   ---------------------------------M--QM----------------------


PLK4_Hsap_SAK                 ----------RLLIGQPLPNKMTVFPKNKSSTDFSSSG--DGN---SFYTQWGN--QETS
PLK3_Hsap_PLK2                ----------K-----VTK---SL------------------------------------
PLK2_Hsap_PLK2                ----------K-----AAA---AL------------------------------------
PLK1_Hsap_PLK1                ----------K-----PLT---VL------------------------------------
polo_Dmel_PLK1                ----------K-----PLM---EM------------------------------------
SAK_Dmel_SAK                  ------------SVENSGPQ----------------------------------------
PLK5_Mmus_PLK2                ----------K-----VGQ---LL------------------------------------
PLK4_Mmus_SAK                 ----------RLLVGQPLPNKITVFQKNKNSSDFS-SG--DGS---NFCTQWGNPEQEAN
PLK3_Mmus_PLK2                ----------K-----VTK---SL------------------------------------
PLK2_Mmus_PLK2                ----------K-----AAA---AL------------------------------------
PLK1_Mmus_PLK1                ----------K-----PLK---VL------------------------------------
plk-2_Cele_PLK1               ----------S-----PSG---TI------------------------------------
plk-1_Cele_PLK1               ----------A--