Protein (view, download) , Domain (view, download)
RIOK3_Hsap_RIO3       MDLVG-VASPE--PGTAAAWGPSKCPWAIPQN-TISCSLADVMSEQLAK-----------
RIOK2_Hsap_RIO2       MGK-------------------------------VNVAKLRYMSRDDFR-----------
RIOK1_Hsap_RIO1       MDYRR-LLMSRVVPGQF-------------------------------D-----------
CG11660_Dmel_RIO1     MNNDS-HKYSDAEEDEE--------------------DLRSSEWTNDFK-----------
CG11859_Dmel_RIO2     MGK-------------------------------LNVTVLRYLTKEDFR-----------
CG3008_Dmel_RIO3      MSSPW-VKTSE--PV-------------------QQVNLADIMSEQYAH-----------
M01B12.5_Cele_RIO1    MEKVEHLNLNIQN----------------------------ILEDVD-------------
aSWK440_Cele_RIO2     MGR-------------------------------MNVSMMRYLEGDHFR-----------
RIO2_Scer_RIO2        MKL--------------------------------DTSHMRYLTTDDFR-----------
RIO1_Scer_RIO1        MSLED-K-----------------------------------------------------
RIOK1_Mmus_RIO1       MDCSL-DRMASVVPGQF-------------------------------D-----------
RIOK2_Mmus_RIO2       MGK-------------------------------VNVAKLRYMSRDDFR-----------
RIOK3_Mmus_RIO3       MDLVG-VSSPE--PGPAAAWGPSKCPWATPQN-TVSCSLTEVMSEELAK-----------
ZK632.3_Cele_RIO3     MANCE-NNPWK--K---NAWGKNEE---T-AE-EPIVSFADVLSEEFIE-----------
Rio1_Ddis_RIO1        MEDSF-KNLTIEN------------------------------K-EQQT-----------
Rio2_Ddis_RIO2        MKL--------------------------------DPKALRYLSKDDFR-----------
11147_Tthe_RIO1       MSQKKETKQKK-I----------------------------VLVDDYFN-----------
27105_Tthe_RIO2       MRL--------------------------------DPSYLEYMTKDEFR-----------
RIO1_Spur_RIO1        IYKTS-I-LTFKDRDKY-------------------------VT-GEFRFRHGYCKSNPR
RIO2_Spur_RIO2        MAA-------------------------------E-----RKISRDRFN-----------
RIO3_Spur_RIO3        MLEEG-KE----------------------------------------------------
CC1G_04984_Ccin_RIO1  MASHE-VE-----PGQF-------------------------------D-----------
CC1G_13652_Ccin_RIO2  MKL--------------------------------DATDLRYVTSEEFR-----------
AqueK049_Aque_RIO1    MRSRL-IF-----PGHP-------------------------------G-----------
AqueK050_Aque_RIO2    MGR-------------------------------LDVSLLRYLTSQDFR-----------
AqueK051_Aque_RIO3    MDSGL-NT-LS--PHKPT---PTKSPWGSPMPATPTCSLASVMDEELAR-----------
RIO1-2_Smoe_RIO1      RPNANG--------------------------------------G---------------
RIO1-1_Smoe_RIO1      RPNANG--------------------------------------G---------------
RIO2-2_Smoe_RIO2      MKL--------------------------------DVNVLRYLSKDEFR-----------
RIO2-1_Smoe_RIO2      MKL--------------------------------DVNVLRYLSKDEFR-----------
GK011_Glam_RIO2       MSKFI-SLIAMPN---------------------LDVSYVDSLPPSYYR-----------
GK010_Glam_RIO1       MNQLRT-V----------------------------------------------------


RIOK3_Hsap_RIO3       --ELQ--LE----EEAAV-F----------PE--V-------------------------
RIOK2_Hsap_RIO2       --VLT--AV----EMGMK-N-HE-I-V-PGSL--IASIA---------------------
RIOK1_Hsap_RIO1       ----D--AD----SSDSE-N-RD-L-K-TV------------------------------
CG11660_Dmel_RIO1     --NLT--LK----HEIFK-D-IK-L-T-PKED--CDDLA---------------------
CG11859_Dmel_RIO2     --VLT--AI----EMGMK-N-HE-L-V-PGPL--AAAIA---------------------
CG3008_Dmel_RIO3      --KLH--DK----ELQRH-TE-K-LKR-PDEQ--IAPVWGSQASSPPAPNAQSIQSDAED
M01B12.5_Cele_RIO1    --------I----DTASS-S-SD-D-E-PEQA--VV------------------------
aSWK440_Cele_RIO2     --VLI--AV----EMGMK-N-HE-V-V-PLAL--VSAIA---------------------
RIO2_Scer_RIO2        --VLQ--AV----EQGSR-S-HE-V-V-PTPL--IHQIS---------------------
RIO1_Scer_RIO1        ------------------------------------------------------------
RIOK1_Mmus_RIO1       ----D--AD----SSDSE-N-KE-L-Q-PI------------------------------
RIOK2_Mmus_RIO2       --VLT--AV----EMGMK-N-HE-I-V-PCSL--IASIA---------------------
RIOK3_Mmus_RIO3       --ELQ--LE----EEAAA-F----------PE--V-------------------------
ZK632.3_Cele_RIO3     --DLS--VQEKLEEERYM-KQLD-QMF-GDTS--V-------------------------
Rio1_Ddis_RIO1        --VTT--TT----TTTTTTT-KK-I-QTLEVP--LR------------------------
Rio2_Ddis_RIO2        --TLV--AV----EMGMK-N-HE-L-V-PVSL--ICTIA---------------------
11147_Tthe_RIO1       --PTK--ED----EQG-N-N-QS-N-N-PENL--DE------------------------
27105_Tthe_RIO2       --VLT--AI----EIGMR-N-HE-L-V-PMHL--IERIS---------------------
RIO1_Spur_RIO1        KMVRT--WA----EKEMR-N-LLRV-Q-PPRNPVSISTA---------------------
RIO2_Spur_RIO2        --AYCSDQL----EMGMK-N-HE-I-V-PSNL--VASIA---------------------
RIO3_Spur_RIO3        ------------------------------------------------------------
CC1G_04984_Ccin_RIO1  ----D--AP----EEING-R-GN-V-A-YI------------------------------
CC1G_13652_Ccin_RIO2  --VLT--AV----EMGSK-N-HE-I-V-PTHL--IVQIS---------------------
AqueK049_Aque_RIO1    ----N--LH----AIHSV------------------------------------------
AqueK050_Aque_RIO2    --VLT--GV----EMGMK-N-HE-I-V-PAEL--ISSIA---------------------
AqueK051_Aque_RIO3    --SFQ--AE----EEKLL-KK-E-MER-PVPS--VSPV----------------------
RIO1-2_Smoe_RIO1      --------V----ENALQ-K-NA-L-Q-PRNN--QN------------------------
RIO1-1_Smoe_RIO1      --------V----ENALQ-R-NA-L-Q-PRNN--QN------------------------
RIO2-2_Smoe_RIO2      --VLT--AV----EMGMK-N-HE-I-V-PAEL--IDRIA---------------------
RIO2-1_Smoe_RIO2      --VLT--AV----EMGMK-N-HE-I-V-PAEL--IDRIA---------------------
GK011_Glam_RIO2       --VLT--AV----EMGMK-N-HD-Y-V-PLNL--VISLS---------------------
GK010_Glam_RIO1       ------------------------------------------------------------


RIOK3_Hsap_RIO3       -------AVAEGPFIT-GENIDTSSDLML-AQMLQMEYDREYDA--QLRREEKKFNGDSK
RIOK2_Hsap_RIO2       -------S-----LKH-GG-----------------------------------------
RIOK1_Hsap_RIO1       -------K-----------EKD---D-IL-FEDLQDN----VNE--NGEGEI--------
CG11660_Dmel_RIO1     -------------------------------QVIATA----NEEDEPEDEEP--------
CG11859_Dmel_RIO2     -------N-----LKS-GG-----------------------------------------
CG3008_Dmel_RIO3      WEDYSALLNDEGNVAE-DIQLPEDSDAVI-AQLLQSQFDHEYNE--ELRRIERQQNKQSK
M01B12.5_Cele_RIO1    --------------------------------------------------------KQEK
aSWK440_Cele_RIO2     -------G-----IHR-GG-----------------------------------------
RIO2_Scer_RIO2        -------G-----MRSQSG-----------------------------------------
RIO1_Scer_RIO1        ------------------------------------------------------------
RIOK1_Mmus_RIO1       -------H-----------AEDG--G-VL-LKSLQNA----AAE---VKGDA--------
RIOK2_Mmus_RIO2       -------S-----LKH-GG-----------------------------------------
RIOK3_Mmus_RIO3       -------VVAEGPFIS-GENIDTSSDLML-AQMLQMEFDREYDA--QLRREEKKFNGDSK
ZK632.3_Cele_RIO3     -------SDDQLPINT-----EGMTDEEV-ALALQRHFDREADV--A-----RAVGSSSS
Rio1_Ddis_RIO1        -----------------------------------RN----GDLIEFSDSDE--------
Rio2_Ddis_RIO2        -------N-----LKY-GG-----------------------------------------
11147_Tthe_RIO1       -----------------------------------QE----YDQ--HSSSDEE---QYKK
27105_Tthe_RIO2       -------H-----LKR-VC-----------------------------------------
RIO1_Spur_RIO1        -------Q-----------IEEG--N-LT-QKVLEAS-----L------EEA--------
RIO2_Spur_RIO2        -------N-----LRH-GG-----------------------------------------
RIO3_Spur_RIO3        ----------------------TDSDLLL-AQMLQLQFNREYDA--ELSREEQKYNKDSK
CC1G_04984_Ccin_RIO1  -------D-----------TVDP--S-TEPQLDLDDH----AWP--PSSDEE--------
CC1G_13652_Ccin_RIO2  -------G-----LRG-GG-----------------------------------------
AqueK049_Aque_RIO1    -------------------MADT--K-VK-EKALEYD----AY----YSQ----------
AqueK050_Aque_RIO2    -------G-----IRS-SG-----------------------------------------
AqueK051_Aque_RIO3    -------GNEELPING-GGAESTDSDFLL-AQMLQLEFDKEHDR--QLTAEEKHYNKQSR
RIO1-2_Smoe_RIO1      ---------------------------------------------------QR---FLSH
RIO1-1_Smoe_RIO1      ---------------------------------------------------QR---FLSH
RIO2-2_Smoe_RIO2      -------G-----LKT-GG-----------------------------------------
RIO2-1_Smoe_RIO2      -------G-----LKT-GG-----------------------------------------
GK011_Glam_RIO2       -------G-----IRH-GS-----------------------------------------
GK010_Glam_RIO1       ------------------------------------------------------------


RIOK3_Hsap_RIO3       VSISFENYRKVH-P--YED-----SD-SSE---DEV--D-WQD-T---RDDPYRPAKPV-
RIOK2_Hsap_RIO2       ------------------------------------------------------------
RIOK1_Hsap_RIO1       --------------EDEE-----EEG-YDD---DDDDWD-WDE-G---VGKLAKGYVWN-
CG11660_Dmel_RIO1     --------------EEYD-----EDD-YDD---IGDDYDTYEE-A---YTGFNKLHVQP-
CG11859_Dmel_RIO2     ------------------------------------------------------------
CG3008_Dmel_RIO3      VTVTLNKFLRDGDAEFLHD--TAEDD-YEE---DEL--E-QQKHDWDRFEDNERQLDSI-
M01B12.5_Cele_RIO1    LEAG----------EQIEEQYDTDSDY------DDDIVE-FAE-A---T-----------
aSWK440_Cele_RIO2     ------------------------------------------------------------
RIO2_Scer_RIO2        ------------------------------------------------------------
RIO1_Scer_RIO1        --------------------------F---------------------------------
RIOK1_Mmus_RIO1       --------------ETDE-----EDD-YDD---D-DDWY-LDD-A---TGKLTKGCTWN-
RIOK2_Mmus_RIO2       ------------------------------------------------------------
RIOK3_Mmus_RIO3       VSISFENYRKVH-P--FED-----SD-SSE---DEV--D-WQD-T---RDDPYRPAKPI-
ZK632.3_Cele_RIO3     VHFTPDRYHPKT-M--Q-E--TD-SE-NED---DDA--L-RQA-A---TDMLYAKLDEE-
Rio1_Ddis_RIO1        -------------------EYYYDDDY--------EEIE-YDS-D---L---SDEENED-
Rio2_Ddis_RIO2        ------------------------------------------------------------
11147_Tthe_RIO1       VSKK----------KKNRK-VSSDDDL--------DELD-YLE-V---A---------VH
27105_Tthe_RIO2       ------------------------------------------------------------
RIO1_Spur_RIO1        --------------EWDE-----DDD-GEE---DDDYYD-WEE-E---STDFTKKFNTV-
RIO2_Spur_RIO2        ------------------------------------------------------------
RIO3_Spur_RIO3        VGISFSNYRSVH-P--AYD--DN-ED-DDD---DDD--D-YQE-EWI-LGDEGREAELL-
CC1G_04984_Ccin_RIO1  --------------DEDHDSLLDEDDYYDNTRVEDEDW---DI-A---ERDFTKQYNRL-
CC1G_13652_Ccin_RIO2  ------------------------------------------------------------
AqueK049_Aque_RIO1    --------------SSEG-----EEE-EEE---DDIGWH-FEE-E---TADFTKKYNAM-
AqueK050_Aque_RIO2    ------------------------------------------------------------
AqueK051_Aque_RIO3    VKISFDNYRSLH-P--AYL--NH-QE-EEE---EE---------V---VDDEYEMTVRI-
RIO1-2_Smoe_RIO1      IRAG----------PL-HE-----------------------------------------
RIO1-1_Smoe_RIO1      IRAG----------PL-HE-----------------------------------------
RIO2-2_Smoe_RIO2      ------------------------------------------------------------
RIO2-1_Smoe_RIO2      ------------------------------------------------------------
GK011_Glam_RIO2       ------------------------------------------------------------
GK010_Glam_RIO1       ------------------------------------------------------------


RIOK3_Hsap_RIO3       -PT---PKKGFIGKGK-DITTKHDEVVC-GRKN----TAR--------------------
RIOK2_Hsap_RIO2       ------------------------------------------------------------
RIOK1_Hsap_RIO1       -GGSN-P-----QANR-Q--TSDSSSAK-MSTP----ADK--------------------
CG11660_Dmel_RIO1     -QLTN-ASGGGSGGGA-GGASGGSQRVS-SYQP----NEK--------------------
CG11859_Dmel_RIO2     ------------------------------------------------------------
CG3008_Dmel_RIO3      -PR---CG-FKVNKEG-EMITKHDPQLC-AVRN----AQR--------------------
M01B12.5_Cele_RIO1    -G-----D----------------------------------------------------
aSWK440_Cele_RIO2     ------------------------------------------------------------
RIO2_Scer_RIO2        ------------------------------------------------------------
RIO1_Scer_RIO1        -DSL-SVSQGAS---D-HI------------------NNQ--------------------
RIOK1_Mmus_RIO1       -GGSN-Y-----QANR-Q--TSNYNSAK-MSTP----IDK--------------------
RIOK2_Mmus_RIO2       ------------------------------------------------------------
RIOK3_Mmus_RIO3       -PT---PKKGFIGKGK-DITTKHDEVVC-GRKN----TAR--------------------
ZK632.3_Cele_RIO3     -NA---TNSRLRPEGPSTSRTKHDTGVS-GRRN----ADK--------------------
Rio1_Ddis_RIO1        -R-----ILGIR-SSI-PL--N-----KTLQPK----AQA--------------------
Rio2_Ddis_RIO2        ------------------------------------------------------------
11147_Tthe_RIO1       KG-----NIGLE-DGQ-GLAVS-----ETNDAK----QGR--------------------
27105_Tthe_RIO2       ------------------------------------------------------------
RIO1_Spur_RIO1        -RACN-P-----QPKR-GMNPANPKEVS-SFQP----HEK--------------------
RIO2_Spur_RIO2        ------------------------------------------------------------
RIO3_Spur_RIO3        -AP---P-SPSPGQKK-SIVTKHDAQVC-GRKN----ASR--------------------
CC1G_04984_Ccin_RIO1  -RQHVAVKTGNA---Q-GSASATNQSASVAALPAVNIPKAVKAAKPTAAIPAGVAAKDRT
CC1G_13652_Ccin_RIO2  ------------------------------------------------------------
AqueK049_Aque_RIO1    -KKG--------------ETQSNPNAARGTSHC----SNN--------------------
AqueK050_Aque_RIO2    ------------------------------------------------------------
AqueK051_Aque_RIO3    -PR---SSGRKKGVSP-GQPTKHDSKIC-GQKN----VRN--------------------
RIO1-2_Smoe_RIO1      ------------------------------------------------------------
RIO1-1_Smoe_RIO1      ------------------------------------------------------------
RIO2-2_Smoe_RIO2      ------------------------------------------------------------
RIO2-1_Smoe_RIO2      ------------------------------------------------------------
GK011_Glam_RIO2       ------------------------------------------------------------
GK010_Glam_RIO1       ------------------------------------------------------------


RIOK3_Hsap_RIO3       ---MENF----APEFQVG--D---------GIGMDLKLSNHVFNALKQ-HAYSEERRSAR
RIOK2_Hsap_RIO2       ---------------------------------CNKVLRELVKHKLIA-WERTKTVQGYR
RIOK1_Hsap_RIO1       --VLRKF----ENKINLD------------K----LNVTDSVINKVTE-KSRQKEADMYR
CG11660_Dmel_RIO1     --LLRRY----SARINVE------------KYDPTTNMSAQAANRLVN-FD---RRDRTQ
CG11859_Dmel_RIO2     ---------------------------------VHKLLKELCKHKLLA-YERGKKYDGYR
CG3008_Dmel_RIO3      ---VMSF----PPEFPTG--D---------AAGFDMKLSNKVFNQLRA-HSRR-----GR
M01B12.5_Cele_RIO1    ------F----TKKLNAARLN---------TIGPNA-ARNRLTVDVERHADTSEDRKRKR
aSWK440_Cele_RIO2     ---------------------------------VARTLNDLCKHSLVA-FERSKKFDGYR
RIO2_Scer_RIO2        ---------------------------------TNRAISDLAKLSLIS-KMRNVKYDGYR
RIO1_Scer_RIO1        --LLEKY----SHKIK---------------------------------TDELSFSRAKT
RIOK1_Mmus_RIO1       --SLRKF----ENKINLN------------K----LNVTDSVTNKVTV-KLRQKEAESYR
RIOK2_Mmus_RIO2       ---------------------------------CNKILRELVKHKLIA-WERTKTVQGYR
RIOK3_Mmus_RIO3       ---MENF----APGFQVG--D---------GIGMDLKLSNHVFNALKQ-HAYSEERRSAR
ZK632.3_Cele_RIO3     --T-FND----RNTLPTG--D---------MVG--DKLNNKVFNKLMA-FGKSESKRQMR
Rio1_Ddis_RIO1        --LEQKY----QNKINVNSIANSISSKRVIDDDSHRALPNSVQNSIKE-IKKKDDKQGVR
Rio2_Ddis_RIO2        ---------------------------------TKKSIQTLHKFKLLF-HDGR-NYDGYK
11147_Tthe_RIO1       --LVAKL----SSKISV---E---------KMGSRTTASHGAMQSIKE-SINKSQKGSNR
27105_Tthe_RIO2       ---------------------------------ASKVVKLLLKNKFIA-HEN-KKFDGYK
RIO1_Spur_RIO1        --SMHRY----ASKITVD------------KYSGPRSLSNSATNSLMK-TKRKVESDRVR
RIO2_Spur_RIO2        ---------------------------------CHKVLKELVRNKLIA-WEHG-KVSGYR
RIO3_Spur_RIO3        --VMNQF----PPAFPTG--N---------SFGMDMKLSNSVYNVLKI-HSQKEESKAQR
CC1G_04984_Ccin_RIO1  TSQLEEYTKKYSSRLA--------------KI-------DTPFTMGVG-VNRKGPSAHAN
CC1G_13652_Ccin_RIO2  ---------------------------------VNKLIGSLAKRNLIS-KVQNAKYEGYR
AqueK049_Aque_RIO1    --PLRKY----ENLINLG------------SYA--PALSSSSLNALEG-LCRKTESLRVR
AqueK050_Aque_RIO2    ---------------------------------CYKILRELAKHRLVT-YEHQ-KVCGYR
AqueK051_Aque_RIO3    ---MEKF----PPDFPMG--D----------VQPGLCLDNSVFNVLKE-HSMREEKQSQR
RIO1-2_Smoe_RIO1      ------W----E-------------------GQTNTVMSNSVTTMVRD-NVRKQAEGRVR
RIO1-1_Smoe_RIO1      ------W----E-------------------GQTNAVMSNSVTTMVRD-NVRKQAEGRVR
RIO2-2_Smoe_RIO2      ---------------------------------AYKNIRTLLRHKLVH-HDST-KYDGYR
RIO2-1_Smoe_RIO2      ---------------------------------AYKNIRTLLRHKLVH-HDST-KYDGYR
GK011_Glam_RIO2       ---------------------------------IPHIVQELLKIKLIS-HIG-APIDGYA
GK010_Glam_RIO1       ------------------------------------------TN---------RVKHARK


RIOK3_Hsap_RIO3       LHEKKEHSTAEKAVDPKTRLLMYKMVNSGMLETITGCISTGKES----------------
RIOK2_Hsap_RIO2       L-----------TNAGYDYLALKTLSSRQVVESVGNQMGVGKES----------------
RIOK1_Hsap_RIO1       IKDKADRATVEQVLDPRTRMILFKMLTRGIITEINGCISTGKEA----------------
CG11660_Dmel_RIO1     VRDKHDRATAEQVMDPRTRMILFKLLNRGMIQEINGCISTGKEA----------------
CG11859_Dmel_RIO2     L-----------TNTGYDYLALKSLTLRGSVSSFGNQIGIGKES----------------
CG3008_Dmel_RIO3      SDKHEKVATAEMGLDAGTRLLLYKLINNQILEQINGIISTGKEA----------------
M01B12.5_Cele_RIO1    VKDRADRATVEQVLDPRTRLVLFRLLQRGTLLNIDGCISTGKEA----------------
aSWK440_Cele_RIO2     L-----------TIRGYDYLALRALCSREVVGSVGNQIGIGKES----------------
RIO2_Scer_RIO2        L-----------TYNGIDYLALKTMLNRDTVYSVGNTIGVGKES----------------
RIO1_Scer_RIO1        SKDKANRATVENVLDPRTMRFLKSMVTRGVIADLNGCLSTGKEA----------------
RIOK1_Mmus_RIO1       IKDKADRATVEQVLDPRTRMILFKLLHKDHISEIHGCISTGKEA----------------
RIOK2_Mmus_RIO2       L-----------TNAGYDYLALKTLSSRQVVESVGNQMGVGKES----------------
RIOK3_Mmus_RIO3       LHEKKEHSTAEKAVDPKTRLLMYKMVNSGMLETITGCISTGKES----------------
ZK632.3_Cele_RIO3     NKDKEEKATMDTSVDSDTRLLLLKWINQGVFDSVDGIIATGKES----------------
Rio1_Ddis_RIO1        IVDKEDRATTEQVLDPRTRLMLFKMINKGAFSEINGCISTGKEA----------------
Rio2_Ddis_RIO2        L-----------TYLGYDFLALKTLVSRGVCSYVGNQIGVGKES----------------
11147_Tthe_RIO1       VKDKSDRATVEQVLDPRTRVILVKLLNKKIINEINGCLSTGKEA----------------
27105_Tthe_RIO2       L-----------TYLGYDYLALQVFIRRGAIKEVLGKVGCGKES----------------
RIO1_Spur_RIO1        VKDKADRATMEQVMDPRTRMILFKMLSRNVIYEINGCISTGKEA----------------
RIO2_Spur_RIO2        L-----------TYPGYDYLALKALVARDAVASVGNQIGVGKES----------------
RIO3_Spur_RIO3        LHEKKEHSTAEMAVDSRTRIMLYKLVNNGMLDSITGTISTGKEA----------------
CC1G_04984_Ccin_RIO1  MKDKSDRATNEQVLDPRTRLILFKMIGRGLIHEVNGCVSTGKEA----------------
CC1G_13652_Ccin_RIO2  L-----------TYGGYDYLAMRALSKRDSMTSVGNQIGVGKES----------------
AqueK049_Aque_RIO1    SKDKSDRATTEQVLDPRTRMILFKLLSRGLLSNISGCVSTGKEA----------------
AqueK050_Aque_RIO2    L-----------TNAGYDYLALRALVSKDVIYSVGNQIGVGKES----------------
AqueK051_Aque_RIO3    HHEKKEHSTQEHVLDPKTRLMLFKMVDSGKLGEVNGCLSTGKEA----------------
RIO1-2_Smoe_RIO1      VHEKSDRATVEQVKKKII----------------FNLLLFHLQA----------------
RIO1-1_Smoe_RIO1      VHEKSDRATVEQVLDPRTRMVLFKMLNRGVFHDINGCISTGKEASFCNCVFLSFNLLLFH
RIO2-2_Smoe_RIO2      L-----------TNLGYDFLAIKTMVNRGLIVGVGRQIGVGKES----------------
RIO2-1_Smoe_RIO2      L-----------TNLGYDFLAIKTMVNRGLIVGVGRQIGVGKES----------------
GK011_Glam_RIO2       L-----------TYMGYDYLSLNVMKRRGVISAIGSRIGVGKEA----------------
GK010_Glam_RIO1       YDDKSDRATTNLVLDDRVRKLIFRLIEKGALLSVDSVINTGKEA----------------
                                                           :    ::

RIOK3_Hsap_RIO3       ---VVFHAYGGSMED-E----KEDS---------KVIPTECAIKVFKTTLNEF---KNRD
RIOK2_Hsap_RIO2       ---DIYIVANEEGQ-------------------------QFALKLHRLGRTSFRNLKNKR
RIOK1_Hsap_RIO1       ---NVYHASTANGE-------------------------SRAIKIYKTSILVF---KDRD
CG11660_Dmel_RIO1     ---NVYHAVSKNGE------------------------EEFAIKIYKTSILVF---KDRD
CG11859_Dmel_RIO2     ---NIYVVADEEGT-------------------------PICLKLHRLGRTCFRNVKAKR
CG3008_Dmel_RIO3      ---VILHANSDANYTGS----NEHGHQSGVLVPPQLLPRECAIKIFKTTLNEF---KQRD
M01B12.5_Cele_RIO1    ---NVYHATGTD-N-------------------------DLAIKIYKTSILTF---KDRE
aSWK440_Cele_RIO2     ---DVYVGGDPELN-------------------------DLCLKFHRLGRTSFRKIKEKR
RIO2_Scer_RIO2        ---DIYKVSDKNGN-------------------------PRVMKIHRLGRTSFHSVRNNR
RIO1_Scer_RIO1        ---NVYHAFAGTGK--APVIDEETGQYE--VLETDGSRAEYAIKIYKTSILVF---KDRE
RIOK1_Mmus_RIO1       ---NVYYASTPSGE-------------------------SRAIKIYKTSILMF---KDRD
RIOK2_Mmus_RIO2       ---DIYIVANEAGQ-------------------------QLALKLHRLGRTSFRNLKNKR
RIOK3_Mmus_RIO3       ---VVFHAYGGSLED-E----KEDG---------KAIPTECAIKVFKTTLNEF---KNRD
ZK632.3_Cele_RIO3     ---AVLHAAQDSA-------------------------TSYAIKVYKTTLSEF---KNRS
Rio1_Ddis_RIO1        ---NVYHAFTPNEE-------------------------ERAVKVYKTSILVF---KDRD
Rio2_Ddis_RIO2        ---DIYIVANDDNQ-------------------------EMVLKLHRLGRVSFKTIKNNR
11147_Tthe_RIO1       ---NVYHASSSNGK-------------------------EYAIKIYKTSILVF---KDRE
27105_Tthe_RIO2       ---DIYKCVNENGD-------------------------FVILKFTRLGRTSFRTIKKNR
RIO1_Spur_RIO1        ---NVYYATTKLGD-------------------------HRAIKIYKTSILTF---KDRD
RIO2_Spur_RIO2        ---DIYIVANDNDE-------------------------QLALKLHRLGRTSFRKLKEKR
RIO3_Spur_RIO3        ---VVIHAYGGQIDD-------------------HIIPPECALKVFKTTLNEF---KKRD
CC1G_04984_Ccin_RIO1  ---NVYHATTPTK-------------------------DHLALKIYKTSILVF---KDRS
CC1G_13652_Ccin_RIO2  ---DIYVVANAEGD-------------------------EMVLKLHRLGRISFRSIKTKR
AqueK049_Aque_RIO1    ---NVYYADSATG--------------------------PCAVKVYKTSILIF---KDRD
AqueK050_Aque_RIO2    ---G---------------------------------------------RTSFRKVKEKR
AqueK051_Aque_RIO3    ---AVYHAEGGG-E-------LEDG---------TAVPDECAIKIFKTTLNEF---FRRD
RIO1-2_Smoe_RIO1      ---NVYHATTESGE-------------------------ELAVKVYKTSILVF---KDRD
RIO1-1_Smoe_RIO1      LQANVYHATTESGE-------------------------ELAVKVYKTSILVF---KDRD
RIO2-2_Smoe_RIO2      ---DIFEVVAEDGQ-------------------------TLALKLHRLGRTSFRAVKSKR
RIO2-1_Smoe_RIO2      ---DIFEVVAEDGQ-------------------------TLALKLHRLGRTSFRAVKSKR
GK011_Glam_RIO2       ---DVYMAMRPNGQ-------------------------YVVLKLHKLGRTSFKTAKTKR
GK010_Glam_RIO1       ---NVFLCNSEAG--------------------------NVALKIYSTSILSF---RNRI
                                                                          *     .

RIOK3_Hsap_RIO3       KYIKDDFRFKD--RFSKLNPRKIIRMWAEKEMHNL----------------------ARM
RIOK2_Hsap_RIO2       DYHKH---------RHNVSWLYLSRLSAMKEFAYM----------------------KAL
RIOK1_Hsap_RIO1       KYVSGEFRFRH--GYCKGNPRKMVKTWAEKEMRNL----------------------IRL
CG11660_Dmel_RIO1     KYVSGEFRFRH--GYCKHNPRKMVRTWAEKEMRNY----------------------LRM
CG11859_Dmel_RIO2     DYHGR---------RHKASWLYLSRISATREFAYM----------------------SAL
CG3008_Dmel_RIO3      RYIKDDYRFKD--RFSKQNHRVIINMWAEKEMHNL----------------------MRM
M01B12.5_Cele_RIO1    RYVTGEFRYRH--GYCKSNPRKMVAVWAEKEMRNL----------------------ARM
aSWK440_Cele_RIO2     DYHKK---------RKSASWLYLSRLAAAKEFAFL----------------------KAL
RIO2_Scer_RIO2        DYLKK--------SNQGANWMHLSRLAANKEYQFM----------------------SML
RIO1_Scer_RIO1        RYVDGEFRFRN--SRSQHNPRKMIKIWAEKEFRNL----------------------KRI
RIOK1_Mmus_RIO1       KYVTGEFRFRR--GYCKGNPRKMVRTWAEKEMRNL----------------------CRL
RIOK2_Mmus_RIO2       DYHKH---------RHNVSWLYLSRLSAMKEFAYM----------------------KAL
RIOK3_Mmus_RIO3       KYIKDDFRFKD--RFSKLNPRKIIRMWAEKEMHNL----------------------TRM
ZK632.3_Cele_RIO3     EYVKDDFRFK--------NPRGVLKIWAEREFMNL----------------------SRM
Rio1_Ddis_RIO1        RYVTGEFRFRR--GYSKHNPRKMVKVWAEKEFRNL----------------------TRL
Rio2_Ddis_RIO2        DYLKH---------RKSASWLYLSRLAALKEFAYM----------------------KAL
11147_Tthe_RIO1       KYVAGEFRFRK--GHCKSNPRKMIKLWAEKEIRNL----------------------KRI
27105_Tthe_RIO2       DYIQH---------RTSYSWLYLSRLSAIKEYTFM----------------------DLL
RIO1_Spur_RIO1        KYVTGEFRFRH--GYCKSNPRKMVRTWAEKEMRNL----------------------LRL
RIO2_Spur_RIO2        DYLGK---------RKSASWLYLSRLAAMKEFAFM----------------------KAL
RIO3_Spur_RIO3        QYIRNDYRFRA--RFKKQNPRKFIQMWAEKEMHNL----------------------NRM
CC1G_04984_Ccin_RIO1  KYVTGEYRFRR--GYS-RNPRKMVRLWAEKEMRNL----------------------RRL
CC1G_13652_Ccin_RIO2  DYMGK---------RKSASWMYLSRLSAQKEYAFM----------------------KVL
AqueK049_Aque_RIO1    RYVNGEYRFRH--GYSRHNPRKMVRLWAEKEMRNL----------------------SRL
AqueK050_Aque_RIO2    DYHRH---------RQTTSWLYLSRLAAQKEYTFMKCTCLMKNTFTVSISALFILSFQVL
AqueK051_Aque_RIO3    KYIKEDYRFKN--RFGKQNPRKIVRLWAEKEMHNL----------------------KRL
RIO1-2_Smoe_RIO1      KYVQGDFRFRH--GYSKHNPRKMVKTWAEKEMRNL----------------------LRL
RIO1-1_Smoe_RIO1      KYVQGDFRFRH--GYSKHNPRKMVKTWAEKEMRNL----------------------LRL
RIO2-2_Smoe_RIO2      DYLKH---------RSSFNWLYLSRLAALKEFAFM----------------------KAL
RIO2-1_Smoe_RIO2      DYLKH---------RSSFNWLYLSRLAALKEFAFM----------------------KAL
GK011_Glam_RIO2       DYMGP---------RKSASWMYLSRLAAVREFGFM----------------------VAL
GK010_Glam_RIO1       EYVEGEHRFETVTRSQKSNSRRMVKLWAEKEFRNL----------------------IRT
                       *                .   .    * :*

RIOK3_Hsap_RIO3       QRAG-IPCPTVVLLKKHILVMSFIGH-DQVPAPKLKEVK---LNS-EE------------
RIOK2_Hsap_RIO2       YERK-FPVPKPIDYNRHAVVMELIN---GYPLCQIHHV--E------D------------
RIOK1_Hsap_RIO1       NTAE-IPCPEPIMLRSHVLVMSFIGK-DDMPAPLLKNVQL---SE-SK------------
CG11660_Dmel_RIO1     RNAG-VPVPEPILLRSHVLVMRFCGR-DGWPAPKLKDVEL---ST-SK------------
CG11859_Dmel_RIO2     YDRG-FPVPKPIDFNRHCVLMDLVK---GWPMTQVHEL--L------D------------
CG3008_Dmel_RIO3      QAIG-LNVPDVVVLKKHVLVMRFIGD-NHNAAPKLKDAR---LSD-AE------------
M01B12.5_Cele_RIO1    HEVG-LPVPKPHLLKGHVLVMDFLGK-DGWPAPLLKNANL---SQ-EVAISKFYQFFVFF
aSWK440_Cele_RIO2     QERG-FPVPKAVDVCRHLVVMQLVV---GQTLCNVTHV--E------D------------
RIO2_Scer_RIO2        YSKG-FKVPEPFDNSRHIVVMELIE---GYPMRRLRKH--K------N------------
RIO1_Scer_RIO1        YQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYPY---KNRDE------------
RIOK1_Mmus_RIO1       KTAN-IPCPEPIRLRSHVLLMGFIGK-DDMPAPLLKNVQL---SE-SK------------
RIOK2_Mmus_RIO2       YERK-FPVPKPIDYNRHAVIMELIN---GYPLCQIHHV--E------D------------
RIOK3_Mmus_RIO3       QKAG-IPCPTVVLLKKHILVMSFIGH-DQVPAPKLKEVK---LSN-EE------------
ZK632.3_Cele_RIO3     AKHG-LPCPQPVKVRRNVLVMSFLGD-QGLAAPRLKNVEWEFFTD-DE------------
Rio1_Ddis_RIO1        KNAG-IPCPTPLILRNHILVMTFIGK-DGYAAPRLKDATV---SQ-EK------------
Rio2_Ddis_RIO2        YENG-FPVPTPIDYNRHCIVMSRAR---GYPLTQIVQL--R------H------------
11147_Tthe_RIO1       YQSS-IPCPEPLIVKSNVLMMEFIGK-DGKAAPRLKDAEN--IEL-EQ------------
27105_Tthe_RIO2       HKNN-FPTPIPIEQNRHGIVMSLIN---GVPMQNISEI--D------N------------
RIO1_Spur_RIO1        HNAG-VRCPEPHVLRSHVLVMDFIGI-DGWPAPLLKDVNL---SE-SK------------
RIO2_Spur_RIO2        YDHG-FPVPTPIDFSRHCVVMELMN---AYPLNQVHTL--D------D------------
RIO3_Spur_RIO3        REAG-IRCPEVVLLRKHILVMSYIGK-DQKAALKLKHVK---FSV-SE------------
CC1G_04984_Ccin_RIO1  RAAG-IESPEPVEVRENVLVMTFVGDRDGWASPRLKDAEL---TT-DQ------------
CC1G_13652_Ccin_RIO2  YEHG-FPIPKPIDQARHCVLMEFIN---AYPLRQISEV--P------S------------
AqueK049_Aque_RIO1    HQNG-IACPRPIILRGHVLVMSFLGS-GGWPHPKLKDANI---TD-KE------------
AqueK050_Aque_RIO2    HERG-FPVPQPMDVNRHCVVMELIN---GYPLCQVRSL--S------K------------
AqueK051_Aque_RIO3    HSHG-IHCPKVVLLKKHVLVMSFIGK-DQIPAPKLKDSQ---LTQ-DQ------------
RIO1-2_Smoe_RIO1      KASG-IRAPSPLVLRLHVLVMDFIGKSDGWAAPRLKDAAL---SD-TK------------
RIO1-1_Smoe_RIO1      KASG-IRAPSPLVLRLHVLVMDFIGKSDGWAAPRLKDAAL---SD-TK------------
RIO2-2_Smoe_RIO2      HEHG-FPTPKAVDWNRHCVLMTLVP---GYPLVQVKEL--K------N------------
RIO2-1_Smoe_RIO2      HEHG-FPTPKAVDWNRHCVLMTLVP---GYPLVQVKEL--K------N------------
GK011_Glam_RIO2       KERS-FPVPDPISINRHCVCMSYVE---GIPMHAIKDIDIE------A------------
GK010_Glam_RIO1       QQLGSICIPKPLFITTTMIGLEFIGY-DRAPAPRLKDVISD-LSQ-AR------------
                           .  *         : :         .   :

RIOK3_Hsap_RIO3       ------------------------------MKEAYYQTLHLMRQLYHECTLVHADLSEYN
RIOK2_Hsap_RIO2       ------------------------------PASVYDEAMELIVKLA-NHGLIHGDFNEFN
RIOK1_Hsap_RIO1       ------------------------------ARELYLQVIQYMRRMYQDARLVHADLSEFN
CG11660_Dmel_RIO1     ------------------------------ARELYRDCVVIMWRIYNQCRLVHADLSEFN
CG11859_Dmel_RIO2     ------------------------------APQVYDDLMNLIVRLG-NSGVIHGDFNEFN
CG3008_Dmel_RIO3      ------------------------------LSCAYEEIVAAMHKLYNEAKLVHADMSEYN
M01B12.5_Cele_RIO1    FDEKNKNLQNFYLKKKNVILSKTSKKPKKDAEPMYVGLVRDMRRLYRECKLVHADLSEFN
aSWK440_Cele_RIO2     ------------------------------AGALYDRLMALIVKMA-RHGVIHGDFNEFN
RIO2_Scer_RIO2        ------------------------------IPKLYSDLMCFIVDLA-NSGLIHCDFNEFN
RIO1_Scer_RIO1        ------------------------------IFHYYHTMVAYMRLLYQVCRLVHADLSEYN
RIOK1_Mmus_RIO1       ------------------------------ARELYLQVIQYMRKMYQDARLVHADLSEFN
RIOK2_Mmus_RIO2       ------------------------------PASVYDEAMELIVKLG-NHGLIHGDFNEFN
RIOK3_Mmus_RIO3       ------------------------------MKDAYYQTLHLMQQLYNECTLVHADLSEYN
ZK632.3_Cele_RIO3     ------------------------------RRNVYDQVQSIMCRMYKECLLVHADLSEFN
Rio1_Ddis_RIO1        ------------------------------FGVIYLDCIKMMRTLFHKCRLVHADLSEYN
Rio2_Ddis_RIO2        ------------------------------PSKVYSDLMNLIVKLA-SYGLIHGDFNEFN
11147_Tthe_RIO1       ------------------------------YSKIYLQLLRDMRTLYQDCRLVHGDLSEYN
27105_Tthe_RIO2       ------------------------------PKYVFDQCFYLIKRLA-ENGLIHSDFNEFN
RIO1_Spur_RIO1        ------------------------------ARELYLECIQQVRRIYQKAKLVHADLSEFN
RIO2_Spur_RIO2        ------------------------------PASVYDDLMNLIVRLA-NHGLIHGDFNEFN
RIO3_Spur_RIO3        ------------------------------AQCVYEEC----------------------
CC1G_04984_Ccin_RIO1  ------------------------------MIPLYSNLLCLIRTMYHDCKLVHADLSEYN
CC1G_13652_Ccin_RIO2  ------------------------------PGKLYSTLMDLIVRFA-QAGLIHGDFNEFN
AqueK049_Aque_RIO1    ------------------------------ARELYLECVLIIRKLFWSCKLVHADLSEYN
AqueK050_Aque_RIO2    ------------------------------PEVLFNTLMALLVRLA-SHGLLHCDFNEFN
AqueK051_Aque_RIO3    ------------------------------LKSAYHQCVQTMEKMYNDCHLVHADLNEFN
RIO1-2_Smoe_RIO1      ------------------------------YRESYLEIVQIMRTMYQRCRLVHGDLSEYN
RIO1-1_Smoe_RIO1      ------------------------------YRESYLEIVQIMRTMYQRCRLVHGDLSEYN
RIO2-2_Smoe_RIO2      ------------------------------PALVFDTVISLIVRLA-EHGLIHCDFNEFN
RIO2-1_Smoe_RIO2      ------------------------------PALVFDTVISLIVRLA-EHGLIHCDFNEFN
GK011_Glam_RIO2       ------------------------------ANLLAKDIHTQMVRML-RYGIVHGDCNEFN
GK010_Glam_RIO1       ------------------------------IIKLYWSIMRVLRTLYIGAGLVHGDLSEYN


RIOK3_Hsap_RIO3       MLWH----------AGKVWLIDVSQSVEPTHPHGL----EFLFRDCRNVSQFFQKGGVKE
RIOK2_Hsap_RIO2       LILDES---------DHITMIDFPQMVSTSHPNAE----WYFDRDVKCIKDFFMKRFSYE
RIOK1_Hsap_RIO1       MLYHG----------GGVYIIDVSQSVEHDHPHAL----EFLRKDCANVNDFFMRHSVAV
CG11660_Dmel_RIO1     ILLQD----------GQLVIIDVSQSVEHDHPHSF----DFLRKDCTNISEFFRKRAVAT
CG11859_Dmel_RIO2     LMVTDA---------GKPILIDFPQMMSTSHENAE----FFFERDVNCVREMFRRKFGYE
CG3008_Dmel_RIO3      ILWF----------EGKCWFIDVAQSVEPKHPSAL----EFLMRDCGNIVNFFERRGLPN
M01B12.5_Cele_RIO1    MLVHD----------GKLWIIDVSQSVEQDHPHAL----EFLRMDCNNVNKFFRELGVPV
aSWK440_Cele_RIO2     LIMLED---------ERIVMIDFPQMVSIDHPNAE----YYFDRDVTCVRTFFKRKFDYE
RIO2_Scer_RIO2        IMIKDKLED---ENDCGFVVIDFPQCISIQHQDAD----YYFQRDVDCIRRFFKKKLKYE
RIO1_Scer_RIO1        TIVHD----------DKLYMIDVSQSVEPEHPMSL----DFLRMDIKNVNLYFEKMGISI
RIOK1_Mmus_RIO1       MLYHG----------GDVYIIDVSQSVEHDHPHAL----EFLRKDCTNVNDFFSKHAVAV
RIOK2_Mmus_RIO2       LMLDKD---------DHITMIDFPQMVSTSHPNAE----WYFDRDVKCIREFFMKRFSYE
RIOK3_Mmus_RIO3       MLWH----------AGKVWLIDVSQSVEPTHPHGL----EFLFRDCRNVSQFFQKGGVTE
ZK632.3_Cele_RIO3     LLLTP---------DNKVHVIDVSQAMDLSHPRSL----QFLTRDIQNIITFFTRIGTPN
Rio1_Ddis_RIO1        MLYYK----------NQLYIIDVSQSVEHDHPHSL----DFLRMDCSNVTDFFRKKEVNT
Rio2_Ddis_RIO2        ILINDE---------EEITLIDFPQMVSTSHLNAE----MYFDRDVTCIRVFFEKRFNFI
11147_Tthe_RIO1       LLYYN----------EKLYMIDVSQSIEHDHAHSL----EFLRRDIVNVNMYFKKKNVIT
27105_Tthe_RIO2       LMVED---------NGKVIMIDFPQMVSTKHKNAQ----FYFDRDVECIHVFFERRFNYQ
RIO1_Spur_RIO1        MLYCQ----------DKLYIIDVSQSVEHDHPSAL----EFLRKDCTNVTEYFRKNGVCT
RIO2_Spur_RIO2        LMLDDQ---------DQITLIDFPQMVSTSHENAE----WYFNRDVQCVVDFFNRRFNYK
RIO3_Spur_RIO3        ------------------------------------------------------------
CC1G_04984_Ccin_RIO1  ILYHE----------GRLCIIDVSQSVEHDHPSAF----DFLRSDIKNVEEFFGKGGVQT
CC1G_13652_Ccin_RIO2  ILIREE--------TGEPVVIDFPQMVSTSHENAE----WYFNRDVECIRTFFRRRFRYE
AqueK049_Aque_RIO1    MLYDTA--------NGCLYIIDVSQSVEHDHPHAL----EFLRKDCTNVTEFFRKKGIAV
AqueK050_Aque_RIO2    IIISDE---------DKPTLIDFPQMVSTSHPDAARYTINYFERDVHCVAEFFSKRFQWR
AqueK051_Aque_RIO3    MLWF----------EGRVYIIDVSQSVEPSHPHGL----EFLLRDCKNVSTYFSKKGLAE
RIO1-2_Smoe_RIO1      VLYHE----------GHLYIIDVSQSVDLDHPRAL----DFLRQDCVHVNDFFKKGGVAV
RIO1-1_Smoe_RIO1      VLYHE----------GHLYIIDVSQSVDLDHPRAL----DFLRQDCVHVNDFFKKGGVAV
RIO2-2_Smoe_RIO2      LLIDDD---------EKVTMIDFPQMVSISHRNAE----SYFDRDVDCIYKFFLKRFNYV
RIO2-1_Smoe_RIO2      LLIDDD---------EKVTMIDFPQMVSISHRNAE----SYFDRDVDCIYKFFLKRFNYV
GK011_Glam_RIO2       AIVQTSDPENCTPETTRVVIIDFPQVIQSIAPEAE----EQFNRDVMSVEGFFNRRFGAD
GK010_Glam_RIO1       LLYLN----------KKLYLIDMGQSVHVTHPNAL----QFLRIDIININFFFARQGIPV


RIOK3_Hsap_RIO3       ALSE-----------------RELFN-AVS--GL-------N---ITAD-----------
RIOK2_Hsap_RIO2       S-EL-----------------FPTFK-DIRR-ED-------TLDV----EVSA-S--GYT
RIOK1_Hsap_RIO1       -MTV-----------------RELFE-FVT--DP-------S---ITHE-----------
CG11660_Dmel_RIO1     -MTV-----------------KELFD-FIT--DQ-------T---ITTE-----------
CG11859_Dmel_RIO2     S-ED-----------------YPKFS-DLVR-ED-------DLDA----EVHC-TGYGFT
CG3008_Dmel_RIO3      IYTK-----------------EQLFE-FIT--GL-------N---SEV------------
M01B12.5_Cele_RIO1    -LSV-----------------RRLFE-VIV--DP-------L---MSSK-----------
aSWK440_Cele_RIO2     S-ED-----------------WPKFD-EVER-KG-------NMDV----LLEA-S--GFT
RIO2_Scer_RIO2        P-KPDSSMLDTEGFGDGYKYAYPDFKRDVKR-TD-------NLDE----LVQA-S--GFS
RIO1_Scer_RIO1        -FPE-----------------RVIFQ-FVI--SE-------T---LEKF-----------
RIOK1_Mmus_RIO1       -MTV-----------------RELFD-FVT--DP-------S---ITAD-----------
RIOK2_Mmus_RIO2       S-EL-----------------YPTFS-DIRK-ED-------SLDV----EVSA-S--GYT
RIOK3_Mmus_RIO3       ALNE-----------------RELFN-AVS--GL-------N---ISAD-----------
ZK632.3_Cele_RIO3     LPTY-----------------VQLFN-LIT--DL-------D---MVED-----------
Rio1_Ddis_RIO1        -MFI-----------------QELFE-FIT--DL-------T---ITED-----------
Rio2_Ddis_RIO2        G-ER-----------------WPKFK-DCQN-IH-------SLDV----EISA-S--GFT
11147_Tthe_RIO1       -FSL-----------------RDIFD-FIT--DI-------N---IVPG-----------
27105_Tthe_RIO2       I-TD-----------------TLDFN-KIAR-LN-------DLDV----QVKA-S--GFI
RIO1_Spur_RIO1        -MTM-----------------RELFE-FVT--DP-------N---ITED-----------
RIO2_Spur_RIO2        S-EL-----------------YPKFS-DITC-EK-------TLDV----DVAA-S--GFS
RIO3_Spur_RIO3        ------------------------------------------------------------
CC1G_04984_Ccin_RIO1  -LGI-----------------RKAFE-FVT--KE-------K---LSEE-----------
CC1G_13652_Ccin_RIO2  S-NL-----------------YPRFK-RTMA-EGSADGNDFRLDV----IVEA-S--GFS
AqueK049_Aque_RIO1    -MNV-----------------KSLFD-FVT--DG-------T---VTVD-----------
AqueK050_Aque_RIO2    P-DEA----------------LPSLN-DIMK-VA-------SLDV----EVNA-S--GAI
AqueK051_Aque_RIO3    TLSH-----------------QDLFN-KIT--GL-------G---ISAV-----------
RIO1-2_Smoe_RIO1      -MTV-----------------RELFD-FIV--DP-------S---INDD-----------
RIO1-1_Smoe_RIO1      -MTV-----------------RELFD-FIV--DP-------S---INDD-----------
RIO2-2_Smoe_RIO2      P-GGNARTLQGIDNNVDEDDTRPDFE-NLARTAG-------ALDK----ELAA-S--GFT
RIO2-1_Smoe_RIO2      P-GGNARTLQGIDNNVDEDDTRPDFV-NLARTAG-------ALDK----ELAA-S--GFT
GK011_Glam_RIO2       I-V------------------LPRYN-EVMR-QI-------SEEELVGQRIDATE--AFV
GK010_Glam_RIO1       -LSA-----------------REVLA-FIC--SP-------N---IPKT-----------


RIOK3_Hsap_RIO3       -NEA-------------D-FLA--------------------------------------
RIOK2_Hsap_RIO2       KEMQADD--EL--LHPL-------------------------------------------
RIOK1_Hsap_RIO1       -NMD-------------A-YLS--------------------------------------
CG11660_Dmel_RIO1     -NME-------------E-CLE--------------------------------------
CG11859_Dmel_RIO2     KEMEQDL--LEE----Y-------------------------------------------
CG3008_Dmel_RIO3      -HTA-------------A-QLE--------------------------------------
M01B12.5_Cele_RIO1    -EME-------------T-IIE--------------------------------------
aSWK440_Cele_RIO2     KKMALDL--NKA-YDEGD-FLAHCEQ----------------------------------
RIO2_Scer_RIO2        KKHPGDRGLETA-VESM-------------------------------------------
RIO1_Scer_RIO1        -KGD-------------YNNISALVAY---------------------------------
RIOK1_Mmus_RIO1       -NMD-------------A-YLE--------------------------------------
RIOK2_Mmus_RIO2       KEMQADD--EL--LHPV-------------------------------------------
RIOK3_Mmus_RIO3       -NEA-------------D-FLA--------------------------------------
ZK632.3_Cele_RIO3     -HD----------------LLV--------------------------------------
Rio1_Ddis_RIO1        -NID-------------Q-YLE--------------------------------------
Rio2_Ddis_RIO2        RDMEKEF--QDL--SKQ-------------------------------------------
11147_Tthe_RIO1       -TEA-------------T-ILE--------------------------------------
27105_Tthe_RIO2       KKEIKNI--DDFDIDLR-------------------------------------------
RIO1_Spur_RIO1        -NIE-------------E-YLDEVIHKTCVSGDHGGPAPLLKDVNLSESKARELYLECIQ
RIO2_Spur_RIO2        KEMEQSL--EEG-TDAL-------------------------------------------
RIO3_Spur_RIO3        ------------------------------------------------------------
CC1G_04984_Ccin_RIO1  -NEG-------------M-SPEEVLQK---------------------------------
CC1G_13652_Ccin_RIO2  KNDMKVL--EEY-MEAA-------------------------------------------
AqueK049_Aque_RIO1    -NID-------------Q-YIE--------------------------------------
AqueK050_Aque_RIO2    KEKSAGV--E--------------------------------------------------
AqueK051_Aque_RIO3    -DDQ-------------E-FLT--------------------------------------
RIO1-2_Smoe_RIO1      -QVE-------------T-YLH--------------------------------------
RIO1-1_Smoe_RIO1      -QVE-------------T-YLH--------------------------------------
RIO2-2_Smoe_RIO2      HQN---------------------------------------------------------
RIO2-1_Smoe_RIO2      HQN---------------------------------------------------------
GK011_Glam_RIO2       KEMVA-------------------------------------------------------
GK010_Glam_RIO1       -DDM-------------YCRPANVV-----------------------------------


RIOK3_Hsap_RIO3       ------------------------------------------------------------
RIOK2_Hsap_RIO2       ------------------------------------------------------------
RIOK1_Hsap_RIO1       ------------------------------------------------------------
CG11660_Dmel_RIO1     ------------------------------------------------------------
CG11859_Dmel_RIO2     ------------------------------------------------------------
CG3008_Dmel_RIO3      ------------------------------------------------------------
M01B12.5_Cele_RIO1    ------------------------------------------------------------
aSWK440_Cele_RIO2     ------------------------------------------------------------
RIO2_Scer_RIO2        ------------------------------------------------------------
RIO1_Scer_RIO1        ------------------------------------------------------------
RIOK1_Mmus_RIO1       ------------------------------------------------------------
RIOK2_Mmus_RIO2       ------------------------------------------------------------
RIOK3_Mmus_RIO3       ------------------------------------------------------------
ZK632.3_Cele_RIO3     ------------------------------------------------------------
Rio1_Ddis_RIO1        ------------------------------------------------------------
Rio2_Ddis_RIO2        ------------------------------------------------------------
11147_Tthe_RIO1       ------------------------------------------------------------
27105_Tthe_RIO2       ------------------------------------------------------------
RIO1_Spur_RIO1        QVRRIYQKAKLVHADLSEFNMLYCQDKLYIIDVSQSVEHDHPSALEFLRKDCTNVTEYFR
RIO2_Spur_RIO2        ------------------------------------------------------------
RIO3_Spur_RIO3        ------------------------------------------------------------
CC1G_04984_Ccin_RIO1  ------------------------------------------------------------
CC1G_13652_Ccin_RIO2  ------------------------------------------------------------
AqueK049_Aque_RIO1    ------------------------------------------------------------
AqueK050_Aque_RIO2    ------------------------------------------------------------
AqueK051_Aque_RIO3    ------------------------------------------------------------
RIO1-2_Smoe_RIO1      ------------------------------------------------------------
RIO1-1_Smoe_RIO1      ------------------------------------------------------------
RIO2-2_Smoe_RIO2      ------------------------------------------------------------
RIO2-1_Smoe_RIO2      ------------------------------------------------------------
GK011_Glam_RIO2       ------------------------------------------------------------
GK010_Glam_RIO1       ------------------------------------------------------------


RIOK3_Hsap_RIO3       -------------------------------EIEALEK-M-----N--------------
RIOK2_Hsap_RIO2       ----------------------------------GPDD-KNI-----ETKEGSEFSF-SD
RIOK1_Hsap_RIO1       -------------------------------KAMEIAS-Q----RTKE-E-RSSQDH-VD
CG11660_Dmel_RIO1     -------------------------------RISERIK-D----RDFD-A-ISAQEK-ID
CG11859_Dmel_RIO2     ----------------------------------GMVD------QADEEDEGEDLEEEEE
CG3008_Dmel_RIO3      -------------------------------QIHTRGA-S----ISQA-T-APNQEE-CP
M01B12.5_Cele_RIO1    -------------------------------EE-----------RV-----LV--NS-ED
aSWK440_Cele_RIO2     -------------------------------ELRNRQE-ED---LGEDEDDSDDSKSME-
RIO2_Scer_RIO2        ----------------------------------R--N-AVY--NSD-DDMSNDEAEEEN
RIO1_Scer_RIO1        -----------------------------IASNL------------PI-K-STEQDE-AE
RIOK1_Mmus_RIO1       -------------------------------KAMEIAS-Q----RTKE-E-KTSQDH-VD
RIOK2_Mmus_RIO2       ----------------------------------GPDD-KIT-----ETEEDSDFTF-SD
RIOK3_Mmus_RIO3       -------------------------------EIEALEK-M-----N--------------
ZK632.3_Cele_RIO3     -------------------------------QVEQFSE-E-----N----------R-SV
Rio1_Ddis_RIO1        -------------------------------KMLEKIQ-S----RG---E-TTDEQK-IQ
Rio2_Ddis_RIO2        ----------------------------------QDDD-EINNNDSDENDEDDDEDDDDD
11147_Tthe_RIO1       -------------------------------ELITK---E-----N-----KDT--E-QD
27105_Tthe_RIO2       ----------------------------------GSDD-D-----GD-DDNSDDENEQND
RIO1_Spur_RIO1        KNGVCTMTMRELFEFVTDPNITEDNIEEYLDEAMEITS-R----KSTT-E-VTAQEE-VD
RIO2_Spur_RIO2        ----------------------------------KMDG-D-C-----EDDETDEEDE-EE
RIO3_Spur_RIO3        ------------------------------------------------------------
CC1G_04984_Ccin_RIO1  ----------------------------WLEEQRTSGGGD----EVEEEK-KAEIAA-HE
CC1G_13652_Ccin_RIO2  ----------------------------------DLEE-EG---TGDEEDESEESEEEE-
AqueK049_Aque_RIO1    -------------------------------EAQKRA--------IEE-K-GTNEDQ-VD
AqueK050_Aque_RIO2    -----------------------------------------------EENEGEEEESKEF
AqueK051_Aque_RIO3    -------------------------------QIRAYTQ-R-----Q----------Q-LL
RIO1-2_Smoe_RIO1      -------------------------------EIQKRIE-E----RI-----SSTADD-VA
RIO1-1_Smoe_RIO1      -------------------------------EIQKRIE-E----RI-----SSTADD-VA
RIO2-2_Smoe_RIO2      ------------------------------------------------------------
RIO2-1_Smoe_RIO2      ------------------------------------------------------------
GK011_Glam_RIO2       ------------------------------------------------------------
GK010_Glam_RIO1       ----------------------------------EY---D----SMSP-R-NAP--S-LD


RIOK3_Hsap_RIO3       ------------------------------------------------------------
RIOK2_Hsap_RIO2       -GEVA----------EKAEVYG--SENE--SER--NCLEE--SEGCYCRS--------SG
RIOK1_Hsap_RIO1       -EEVF----------KRAYIPRTLNEVK--NYE--RDMDI--IM---KLKEEDMAMNAQ-
CG11660_Dmel_RIO1     -EAVW----------QNTYIPKRLDEVR--HFE--RDVAK--AK---Q---------GV-
CG11859_Dmel_RIO2     -PPTL----------VTA--AS--VEID--ECR--RQV-E--NEVIYS----------EA
CG3008_Dmel_RIO3      -DE-----------------------LK--PLE--YPFEL--A-----------------
M01B12.5_Cele_RIO1    -DSLF----------MNAFIPHKLEHVL--HFE--RDGKL--AK---EG---------V-
aSWK440_Cele_RIO2     --DIQ----------EEPE------DLE--KD-----HEE--LQ----------------
RIO2_Scer_RIO2        ----G----------EG--------DYS--------------------------------
RIO1_Scer_RIO1        -DEIF----------RSLHLVRSLGGLE----E--RDFDR--YT---D---------GK-
RIOK1_Mmus_RIO1       -EEVF----------KQAYIPRTLNEVK--NYE--RDVDI--MM---RLKEEDMALNTQ-
RIOK2_Mmus_RIO2       -EEML----------EKAKVWR--SELE--KEA--DPADE--SGGSWCCS--------ST
RIOK3_Mmus_RIO3       ------------------------------------------------------------
ZK632.3_Cele_RIO3     -DL-----------------------RH--DKS--RPAD---------------------
Rio1_Ddis_RIO1        -EEVF----------RNAYIPRTLDQII--DLD--RDMEK--IE---RG---------E-
Rio2_Ddis_RIO2        -DENN----------DDDENND--NNIE--NEN---------------------------
11147_Tthe_RIO1       -EKIF----------AGMYIPRTLNEVSFKNIE--ANIDKNILN---EG------SD-E-
27105_Tthe_RIO2       LDKNI----------EQ-EDSD--NEIE--ESN--KRI-----QNLNIL-----------
RIO1_Spur_RIO1        -EEVF----------RQAFIPQKLEEVK--HYE--KEIVK--AK---E---------NK-
RIO2_Spur_RIO2        -EGVV----------EEMKNPH--DGLQ--DSG---------------------------
RIO3_Spur_RIO3        ------------------------------------------------------------
CC1G_04984_Ccin_RIO1  -DEVF----------MKSYIPRTLNEVY--DPE--RDVDR--LT---R---------GE-
CC1G_13652_Ccin_RIO2  ----E----------EEEE------E-E--EE-----GEE--------------------
AqueK049_Aque_RIO1    -DAVF----------KNIYIPQSLHEVS--RYE--SDVSE--AQ---T---------GS-
AqueK050_Aque_RIO2    -ECSL----------AS----------------------H--VKGIHI------------
AqueK051_Aque_RIO3    -DV-----------------------IY--DKKEPYPFDF--F-----------------
RIO1-2_Smoe_RIO1      -DAVF----------VQAFIPRTLDQVQ--DYE--RDIQR--IA---TG---------K-
RIO1-1_Smoe_RIO1      -DAVF----------VQAFIPRTLDQVQ--DYE--RDIQR--IA---TG---------N-
RIO2-2_Smoe_RIO2      ------------------------------------------------------------
RIO2-1_Smoe_RIO2      ------------------------------------------------------------
GK011_Glam_RIO2       ----------------K-YDPD--EEL---------------------------------
GK010_Glam_RIO1       -PKLTAYIRYLRAECARLYTPEEV------NGE--RDIVN--YP----------------


RIOK3_Hsap_RIO3       ------------------------------------------------------------
RIOK2_Hsap_RIO2       DPEQIKEDSLS-------EESADARS---FEMTEFN------------------------
RIOK1_Hsap_RIO1       -----------QD-NILYQTVTGLKKDLS-------GVQ---------------------
CG11660_Dmel_RIO1     -----------QQ-NLIYGKITGLTSDLD--------VQ---------------------
CG11859_Dmel_RIO2     KPTQKSDDAVR-------RYIESCT----QYLGNLSVGP---------------------
CG3008_Dmel_RIO3      -----------------WEK----------------------------------------
M01B12.5_Cele_RIO1    -----------EANN-PFQNIVS-KIDLK-------------------------------
aSWK440_Cele_RIO2     ----AQENTVKQQ-KIVLSQTTRFTDWLSDATNQLE------------------------
RIO2_Scer_RIO2        ------------------------------------------------------------
RIO1_Scer_RIO1        -----------F--DL----LKSLIAHDN-------E-----------------------
RIOK1_Mmus_RIO1       -----------QD-NILYQTVMGLKKDLS-------GVQ---------------------
RIOK2_Mmus_RIO2       DSKQIKDGGLP-------EESAHVSS---FEVTALS------------------------
RIOK3_Mmus_RIO3       ------------------------------------------------------------
ZK632.3_Cele_RIO3     ------------------------------------------------------------
Rio1_Ddis_RIO1        -----------GR-DIFYQNLTGLSKDLQ-------NIK---------------------
Rio2_Ddis_RIO2        ----------E-------ENIKKSSK---VNK---K------------------------
11147_Tthe_RIO1       -----------EAKDIVYSKLTGLITKSN-------NQQNYESESDDDEDDDNEDENNSE
27105_Tthe_RIO2       NDEDISQDENE-------EEQKNNKK---Q------------------------------
RIO1_Spur_RIO1        -----------EH-EMYYKTITGLKGDLS-------GIQ---------------------
RIO2_Spur_RIO2        -----SEDKNS-------EEVQSIRE---DDTGGMS------------------------
RIO3_Spur_RIO3        ------------------------------------------------------------
CC1G_04984_Ccin_RIO1  -----------GK-QLIYAETIGVVAPAS-------A-----------------------
CC1G_13652_Ccin_RIO2  ----SEEGG---------------------------------------------------
AqueK049_Aque_RIO1    -----------KT-DIAYQTITGLKPDLS-------GTL---------------------
AqueK050_Aque_RIO2    ----TDEDKLR-------ENVSEFDS--------IS------------------------
AqueK051_Aque_RIO3    -----------------FEETMN-------------------------------------
RIO1-2_Smoe_RIO1      -----------DTEGIYYQTITGLKEDLS-------GVR---------------------
RIO1-1_Smoe_RIO1      -----------DTEGIYYQTITGLKEDLS-------GVR---------------------
RIO2-2_Smoe_RIO2      ------------------------------------------------------------
RIO2-1_Smoe_RIO2      ------------------------------------------------------------
GK011_Glam_RIO2       ------------------------------------------------------------
GK010_Glam_RIO1       ----------------VFESLSAITA----------------------------------


RIOK3_Hsap_RIO3       --------------------------------------------------------EDH-
RIOK2_Hsap_RIO2       -----------------------------------------------QALEE-IK-GQVV
RIOK1_Hsap_RIO1       -------------------------------------KVPA-------LLEN-Q------
CG11660_Dmel_RIO1     -------------------------------------QKPD-------VLQS-S------
CG11859_Dmel_RIO2     -------------------------------------EVPDQTMPKKLDISLPAETPDVI
CG3008_Dmel_RIO3      -----------------------------------------------------SQ-QDRA
M01B12.5_Cele_RIO1    ------------------------------------------------------------
aSWK440_Cele_RIO2     --------------------------------------------AVD--LD-------AL
RIO2_Scer_RIO2        ------------------------------------------------------------
RIO1_Scer_RIO1        --------------------------------------------------RN-FA-ASEQ
RIOK1_Mmus_RIO1       -------------------------------------KVPA-------LLES-E------
RIOK2_Mmus_RIO2       -----------------------------------------------QAVEE-ME-RQVL
RIOK3_Mmus_RIO3       --------------------------------------------------------EDH-
ZK632.3_Cele_RIO3     ------------------------------------------------------------
Rio1_Ddis_RIO1        -------------------------------------SKND-------LIND-SN-----
Rio2_Ddis_RIO2        --------------------------------------------EVGKEIKK-EE-E---
11147_Tthe_RIO1       DDTDKQIEAAKPNKFIKIVTKNEEDGGTEESKQKAQEEVSQ-------LLKQ-IQ-SNKQ
27105_Tthe_RIO2       -------------------------------------------------------KKHHL
RIO1_Spur_RIO1        -------------------------------------EDPA-------LLED-RL-TGPG
RIO2_Spur_RIO2        --------------------------------------------GVGQDNDD-QE-HCIM
RIO3_Spur_RIO3        ------------------------------------------------------------
CC1G_04984_Ccin_RIO1  --------------------------------------------------EN-TA-GDKE
CC1G_13652_Ccin_RIO2  ------------------------------------------------------------
AqueK049_Aque_RIO1    -------------------------------------LVPQ-------LLQN-GE-ENKS
AqueK050_Aque_RIO2    --------------------------------------------SIP--LD-------EI
AqueK051_Aque_RIO3    -----------------------------------------------------SR-QDNS
RIO1-2_Smoe_RIO1      -------------------------------------QVPS-------LLEK-QE-KQPA
RIO1-1_Smoe_RIO1      -------------------------------------KVPS-------LLEK-QE-KQPA
RIO2-2_Smoe_RIO2      ------------------------------------------------------------
RIO2-1_Smoe_RIO2      ------------------------------------------------------------
GK011_Glam_RIO2       ------------------------------------------------------------
GK010_Glam_RIO1       ---------------------------------------TD-------YLDN-NY-ADYS


RIOK3_Hsap_RIO3       -----------------------------------V-Q-KNGRKA--------AS-----
RIOK2_Hsap_RIO2       ---------------ENN-SVTEF-SE-E--KNRTENYNRQDGQRVQGGVPAGS------
RIOK1_Hsap_RIO1       ------------------VEERTC-SD-S--EDIGSSE-CSDT-D--------SE-----
CG11660_Dmel_RIO1     -----------------TAKEDDG-SE-A--QTSGSED-EDNSQD--------ND-----
CG11859_Dmel_RIO2     PFE-----------AETSATNTVE-ED-V--KSISSN----------------D------
CG3008_Dmel_RIO3      AQKA------------LQQ-A----QD-N--NDNK-TD-TDKDQE--------TD-----
M01B12.5_Cele_RIO1    ------------------GDG--F-GE----EHDDSDD-NDDEEN--------GK-----
aSWK440_Cele_RIO2     KSE-----------EGYKDIELPP-ED-FKRPADSEND-DENDED--------EE-----
RIO2_Scer_RIO2        -----------------------E-ED-E--YYDSELD-NE-------------------
RIO1_Scer_RIO1        -FE------FDNADHECSSGTEEF-SD-D--EEDGSSG-SEED-D--------EE-----
RIOK1_Mmus_RIO1       ------------------VKEETC-FG-S--DDAGGSE-CSDT-V--------SE-----
RIOK2_Mmus_RIO2       ---------------PHR-SVTEF-SE-E--SRRTEND-GQPGQR----SPAGS------
RIOK3_Mmus_RIO3       -----------------------------------I-Q-KNGRKA--------AS-----
ZK632.3_Cele_RIO3     ---------------------------------MEL-K----------------K-----
Rio1_Ddis_RIO1        ---------------ENKD----S-DD-S--SSDSSED-SDDDSD--------SD-----
Rio2_Ddis_RIO2        ---------------EN--NNSEE-ED-E--EEEEEE----------------D------
11147_Tthe_RIO1       K-------------QEDDDSSLSSSSD-S--DSDDSED-SDEDED--------DE-----
27105_Tthe_RIO2       KKQ-----------SKSKSKKQNQ-EQ-E--GKDGE-----DDED----NQ--KNNFSPD
RIO1_Spur_RIO1        QTQ----------GKG-EAGEEEE-ME-E--EEEEEEE-EDDEES--------GE-----
RIO2_Spur_RIO2        ---------------V-M-DGNEQ-EQ-S--GKEKEN----------------H------
RIO3_Spur_RIO3        ------------------------------------------------------------
CC1G_04984_Ccin_RIO1  AAP------TYNPSQQ--TG-----TD-P--DKDGEEE-EGDE-D--------ED-----
CC1G_13652_Ccin_RIO2  -------------------LSMPA-QRTYDGPSEGESR-QKT-----------SE-----
AqueK049_Aque_RIO1    DFNNVRDQEINDLYQE-SANVDQE-SG-D--DSSQISN-TDDSSN--------DE-----
AqueK050_Aque_RIO2    PLE-----------SEDKDYVNNK-ED-T---LEYISD-SEEYES--------S------
AqueK051_Aque_RIO3    GSIG----------VDVKRGK----KD-L--NESKSSE-SNEEEV--------LS-----
RIO1-2_Smoe_RIO1      T-------------AEAETDQLVL-SG-A--ASSSSDS-SDQEGD--------SE-----
RIO1-1_Smoe_RIO1      T-------------REAETEQLVL-SE-A--ASSSSDS-SDQEED--------SE-----
RIO2-2_Smoe_RIO2      ------------------------------------------------------------
RIO2-1_Smoe_RIO2      ------------------------------------------------------------
GK011_Glam_RIO2       ----------------------------E--IKEGD-----EAVD----EC--SN-----
GK010_Glam_RIO1       QLQ------ALNI--EL--YESDD-SD-S--EQSE-SD-QNSSEA--------NE-----


RIOK3_Hsap_RIO3       ------------------FL-K------DD------------------------------
RIOK2_Hsap_RIO2       -------------------DEY------EDECPHLIALS---SLNREFRPFRDEENVGAM
RIOK1_Hsap_RIO1       ------------------EQ--------GDHAR-P--------------------KKH--
CG11660_Dmel_RIO1     ------------------ND--------EDAKK-F--------------------KNSA-
CG11859_Dmel_RIO2     -------------------LDT------DE-VPELVGLD---PNSRMYRLKMVEQMLNDA
CG3008_Dmel_RIO3      ------------------DN-E------ND------------------------------
M01B12.5_Cele_RIO1    ------------------KSRKKRAEPTEEEIQ-E-----------K--E--RKIAMHT-
aSWK440_Cele_RIO2     ------------------EGEE------EDADGHVA----------------VEEQVAKV
RIO2_Scer_RIO2        -------------------SSE------DDS-----------------------------
RIO1_Scer_RIO1        ------------------EGEY------YDDDE-P--------------------KVLK-
RIOK1_Mmus_RIO1       ------------------EQ--------EDQAG-C--------------------RNH--
RIOK2_Mmus_RIO2       -------------------EDC------DDEPPHLIALS---SVNREFRPFRDEESMSSV
RIOK3_Mmus_RIO3       ------------------FL-K------DD------------------------------
ZK632.3_Cele_RIO3     ------------------YN-E------EK------------------------------
Rio1_Ddis_RIO1        ------------------QLNE------DDEKI-R-----------K--LVVIDPITKM-
Rio2_Ddis_RIO2        -------------------SDS------EESVE---DN----------TP-----VIEEF
11147_Tthe_RIO1       ------------------NDSD------DDDKQ-Q-----------D--S--EETKKKK-
27105_Tthe_RIO2       LSEISIEDLKELQKVNQDLFSD------DDNEDDPLALNEVKDINGNIVVP--EQKEKK-
RIO1_Spur_RIO1        ------------------ED--------EEKTS-E--------------------RQHH-
RIO2_Spur_RIO2        -------------------SDD------DDDLE---DIG---ASNKQYRPHRSEASMSKA
RIO3_Spur_RIO3        ------------------------------------------------------------
CC1G_04984_Ccin_RIO1  ------------------GSEE------EDDDE-E-------------------------
CC1G_13652_Ccin_RIO2  ------------------STQQ------EDGTPDIS----------------V-------
AqueK049_Aque_RIO1    ------------------ESVS------GDCWE-E--------------------REK--
AqueK050_Aque_RIO2    -------------------SEG------EET-----------------------------
AqueK051_Aque_RIO3    ------------------ET-E------EE------------------------------
RIO1-2_Smoe_RIO1      ------------------ED----------ET-------------------------NK-
RIO1-1_Smoe_RIO1      ------------------EE----------DA-------------------------NK-
RIO2-2_Smoe_RIO2      ------------------------------------------------------------
RIO2-1_Smoe_RIO2      ------------------------------------------------------------
GK011_Glam_RIO2       ------------------SMVD------DDADP-V--------------------DKSK-
GK010_Glam_RIO1       ------------------EI--------EERER-------------N--L-----KMLS-


RIOK3_Hsap_RIO3       ------------------------------------------------------------
RIOK2_Hsap_RIO2       NQY----RT--RTLSI---------------------TSSGSAVSCSTIPPELVKQK--V
RIOK1_Hsap_RIO1       -----------T------------------------------------TDPDIDK-K--E
CG11660_Dmel_RIO1     -------RP--R------------------------------------EESPESK-K--A
CG11859_Dmel_RIO2     RS------Q------------------------------RSYSTTTSTIAPSVITDR--I
CG3008_Dmel_RIO3      ------------------------------------------------------------
M01B12.5_Cele_RIO1    -------RN--R------------------------------------EETAEER-K--E
aSWK440_Cele_RIO2     VK-----KK--RVPS----------------------GARSVASSAATFTAEDVKRR--L
RIO2_Scer_RIO2        ------------------------------------------------------------
RIO1_Scer_RIO1        -------GK--K------------------------------------HEDKDLK-K--L
RIOK1_Mmus_RIO1       -----------I------------------------------------ADPDIDK-K--E
RIOK2_Mmus_RIO2       TRH----RT--RTLSV---------------------TSAGSALSCSTIPPELVKQK--V
RIOK3_Mmus_RIO3       ------------------------------------------------------------
ZK632.3_Cele_RIO3     ------------------------------------------------------------
Rio1_Ddis_RIO1        -------EI--R-------------------------------------LEDMPK-K--D
Rio2_Ddis_RIO2        KGLSLNK-----NRDFKFSNLKDEDQNAPIVLRKEFIEN--LD---ENQPTEP-K-K--E
11147_Tthe_RIO1       -------KGGDQ------------------------------------LYQGLSK-D--E
27105_Tthe_RIO2       -KP----KK--KMVD--------------------------IANEQDQDNKQDLKEKIYI
RIO1_Spur_RIO1        -------RP--R------------------------------------DESPTAK-K--E
RIO2_Spur_RIO2        NAHSLNARS--RNSDS---------------------I-SSYTSTSSTMNPALVRSK--V
RIO3_Spur_RIO3        ------------------------------------------------------------
CC1G_04984_Ccin_RIO1  ---------------------------------------------------ED-------
CC1G_13652_Ccin_RIO2  LN-----IS--RE------------------------SSRSA-SPEPDTVKDDIKAR--A
AqueK049_Aque_RIO1    -------PS--K------------------------------------EEISRQR-K--E
AqueK050_Aque_RIO2    -----------------------------------------------SIASKDLKKQ--V
AqueK051_Aque_RIO3    ------------------------------------------------------------
RIO1-2_Smoe_RIO1      -------ES--R------------------------------------EERRSAR-K--E
RIO1-1_Smoe_RIO1      -------ES--R------------------------------------EERRSAR-K--E
RIO2-2_Smoe_RIO2      ------------------------------------------------------------
RIO2-1_Smoe_RIO2      ------------------------------------------------------------
GK011_Glam_RIO2       -EP----RM--RKV-------------------------------------VDIRQA--V
GK010_Glam_RIO1       -------R---S------------------------------------DYSKEEW-R--E


RIOK3_Hsap_RIO3       --------------------------------------------------------GD-P
RIOK2_Hsap_RIO2       KR-QLTKQQKSA---------VRRRL---------QKGEANIFTKQRRENMQNIKSSLEA
RIOK1_Hsap_RIO1       RK-KMVKEAQR----EKRKNKIPKHVKK------------------RKEK------TAK-
CG11660_Dmel_RIO1     RK-KAVKDAKA----EQRKVKVKKHVKK------------------RKEK------M---
CG11859_Dmel_RIO2     RR-NMDIKEKR----EQRKKCV-------------AKGEASAVHRHRKENKDV----VKE
CG3008_Dmel_RIO3      ----------S------------------------------------DDK---