Protein (view, download) , Domain (view, download)
PRP4_Hsap_PRP4         ------------------------------------------------------------
HIPK4_Hsap_HIPK        ------------------------------------------------------------
HIPK3_Hsap_HIPK        ------------------------------------------------------------
HIPK2_Hsap_HIPK        ------------------------------------------------------------
HIPK1_Hsap_HIPK        ------------------------------------------------------------
smi35A_Dmel_DYRK2      ------------------------------------------------------------
mnb_Dmel_DYRK1         ------------------------------------------------------------
Dyrk3_Dmel_DYRK2       ------------------------------------------------------------
CG17090_Dmel_HIPK      ------------------------------------------------------------
PRP4_Mmus_PRP4         ------------------------------------------------------------
HIPK4_Mmus_HIPK        ------------------------------------------------------------
HIPK3_Mmus_HIPK        ------------------------------------------------------------
HIPK2_Mmus_HIPK        ------------------------------------------------------------
HIPK1_Mmus_HIPK        ------------------------------------------------------------
DYRK4_Mmus_DYRK2       ------------------------------------------------------------
DYRK3_Mmus_DYRK2       ------------------------------------------------------------
DYRK2_Mmus_DYRK2       ------------------------------------------------------------
DYRK1B_Mmus_DYRK1      ------------------------------------------------------------
DYRK1A_Mmus_DYRK1      ------------------------------------------------------------
mbk-2_Cele_DYRK2       ------------------------------------------------------------
mbk-1_Cele_DYRK1       ------------------------------------------------------------
hpk-1_Cele_HIPK        ------------------------------------------------------------
F22D6.5_Cele_PRP4      ------------------------------------------------------------
C36B7.2_Cele_DYRK2     ------------------------------------------------------------
C36B7.1_Cele_DYRK2     ------------------------------------------------------------
DYRK4_Hsap_DYRK2       ------------------------------------------------------------
DYRK3_Hsap_DYRK2       ------------------------------------------------------------
DYRK2_Hsap_DYRK2       ------------------------------------------------------------
DYRK1B_Hsap_DYRK1      ------------------------------------------------------------
DYRK1A_Hsap_DYRK1      ------------------------------------------------------------
YAK1_Scer_YAK          ------------------------------------------------------------
Dyrk1_Ddis_DYRK1       ------------------------------------------------------------
Dyrk2_Ddis_DYRK2       ------------------------------------------------------------
Prp4_Ddis_PRP4         ------------------------------------------------------------
YakA_Ddis_YAK          ------------------------------------------------------------
22349_Tthe_YAK         ------------------------------------------------------------
10580_Tthe_DyrkP       ------------------------------------------------------------
22423_Tthe_DyrkP       ------------------------------------------------------------
5306_Tthe_DYRK2        ------------------------------------------------------------
5356_Tthe_DYRK2        ------------------------------------------------------------
5655_Tthe_DYRK2        ------------------------------------------------------------
15575_Tthe_PRP4        KQ----------------------------------------------------------
DYRK1_Spur_DYRK1       ------------------------------------------------------------
DYRK2_Spur_DYRK2       ------------------------------------------------------------
DYRK4_Spur_DYRK2       ------------------------------------------------------------
HIPKa_Spur_HIPK        ------------------------------------------------------------
HIPKb_Spur_HIPK        ------------------------------------------------------------
PRP4_Spur_PRP4         KHKHKSKKSHHKHKHHKENKDGHRRHKHKHKKHKSKKDEEPPVATPAADESESDIELEDT
CG7028_Dmel_PRP4       ------------------------------------------------------------
CC1G_13957_Ccin_DYRK2  ------------------------------------------------------------
CC1G_04865_Ccin_PRP4   ------------------------------------------------------------
CC1G_14245_Ccin_YAK    ------------------------------------------------------------
AqueK110_Aque_DYRK1    ------------------------------------------------------------
AqueK111_Aque_DYRK1    ------------------------------------------------------------
AqueK112_Aque_DYRK2    ------------------------------------------------------------
AqueK113_Aque_DYRK2    ------------------------------------------------------------
AqueK114_Aque_HIPK     ------------------------------------------------------------
AqueK115_Aque_PRP4     ------------------------------------------------------------
AqueK116_Aque_PRP4     ------------------------------------------------------------
DYRK2_b_Smoe_DYRK2     ------------------------------------------------------------
DYRK2_a_Smoe_DYRK2     ------------------------------------------------------------
DYRKP-2_Smoe_DYRKP     ------------------------------------------------------------
DYRKP-1_Smoe_DYRKP     ------------------------------------------------------------
PRP4_e_Smoe_PRP4       ------------------------------------------------------------
PRP4_d_Smoe_PRP4       ------------------------------------------------------------
PRP4_b_Smoe_PRP4       ------------------------------------------------------------
PRP4_a_Smoe_PRP4       ------------------------------------------------------------
PRP4_c_Smoe_PRP4       ------------------------------------------------------------
YAK_b_Smoe_YAK         ------------------------------------------------------------
YAK_a_Smoe_YAK         ------------------------------------------------------------
YAK_d_Smoe_YAK         ------------------------------------------------------------
GK031_Glam_DYRK1       ------------------------------------------------------------
GK034_Glam_DYRK2       ------------------------------------------------------------
GK033_Glam_DYRK2       ------------------------------------------------------------
GK032_Glam_DYRK2       ------------------------------------------------------------


PRP4_Hsap_PRP4         ------------------------------------------------------------
HIPK4_Hsap_HIPK        ------------------------------------------------------------
HIPK3_Hsap_HIPK        ------------------------------------------------------------
HIPK2_Hsap_HIPK        ------------------------------------------------------------
HIPK1_Hsap_HIPK        ------------------------------------------------------------
smi35A_Dmel_DYRK2      ------------------------------------------------------------
mnb_Dmel_DYRK1         ------------------------------------------------------------
Dyrk3_Dmel_DYRK2       ------------------------------------------------------------
CG17090_Dmel_HIPK      ------------------------------------------------------------
PRP4_Mmus_PRP4         ------------------------------------------------------------
HIPK4_Mmus_HIPK        ------------------------------------------------------------
HIPK3_Mmus_HIPK        ------------------------------------------------------------
HIPK2_Mmus_HIPK        ------------------------------------------------------------
HIPK1_Mmus_HIPK        ------------------------------------------------------------
DYRK4_Mmus_DYRK2       ------------------------------------------------------------
DYRK3_Mmus_DYRK2       ------------------------------------------------------------
DYRK2_Mmus_DYRK2       ------------------------------------------------------------
DYRK1B_Mmus_DYRK1      ------------------------------------------------------------
DYRK1A_Mmus_DYRK1      ------------------------------------------------------------
mbk-2_Cele_DYRK2       ------------------------------------------------------------
mbk-1_Cele_DYRK1       ------------------------------------------------------------
hpk-1_Cele_HIPK        ------------------------------------------------------------
F22D6.5_Cele_PRP4      ------------------------------------------------------------
C36B7.2_Cele_DYRK2     ------------------------------------------------------------
C36B7.1_Cele_DYRK2     ------------------------------------------------------------
DYRK4_Hsap_DYRK2       ------------------------------------------------------------
DYRK3_Hsap_DYRK2       ------------------------------------------------------------
DYRK2_Hsap_DYRK2       ------------------------------------------------------------
DYRK1B_Hsap_DYRK1      ------------------------------------------------------------
DYRK1A_Hsap_DYRK1      ------------------------------------------------------------
YAK1_Scer_YAK          ------------------------------------------------------------
Dyrk1_Ddis_DYRK1       ------------------------------------------------------------
Dyrk2_Ddis_DYRK2       ------------------------------------------------------------
Prp4_Ddis_PRP4         ------------------------------------------------------------
YakA_Ddis_YAK          ------------------------------------------------------------
22349_Tthe_YAK         ------------------------------------------------------------
10580_Tthe_DyrkP       ------------------------------------------------------------
22423_Tthe_DyrkP       ------------------------------------------------------------
5306_Tthe_DYRK2        ------------------------------------------------------------
5356_Tthe_DYRK2        ------------------------------------------------------------
5655_Tthe_DYRK2        ------------------------------------------------------------
15575_Tthe_PRP4        ------------------------------------------------------------
DYRK1_Spur_DYRK1       ------------------------------------------------------------
DYRK2_Spur_DYRK2       ------------------------------------------------------------
DYRK4_Spur_DYRK2       ------------------------------------------------------------
HIPKa_Spur_HIPK        ------------------------------------------------------------
HIPKb_Spur_HIPK        ------------------------------------------------------------
PRP4_Spur_PRP4         IPLPKFEPKIPPPPPPPNSRRESGRKERGRGGDDTLAALEKQKELLQAQLLATAEDEHSG
CG7028_Dmel_PRP4       ------------------------------------------------------------
CC1G_13957_Ccin_DYRK2  ------------------------------------------------------------
CC1G_04865_Ccin_PRP4   ------------------------------------------------------------
CC1G_14245_Ccin_YAK    ------------------------------------------------------------
AqueK110_Aque_DYRK1    ------------------------------------------------------------
AqueK111_Aque_DYRK1    ------------------------------------------------------------
AqueK112_Aque_DYRK2    ------------------------------------------------------------
AqueK113_Aque_DYRK2    ------------------------------------------------------------
AqueK114_Aque_HIPK     ------------------------------------------------------------
AqueK115_Aque_PRP4     ------------------------------------------------------------
AqueK116_Aque_PRP4     ------------------------------------------------------------
DYRK2_b_Smoe_DYRK2     ------------------------------------------------------------
DYRK2_a_Smoe_DYRK2     ------------------------------------------------------------
DYRKP-2_Smoe_DYRKP     ------------------------------------------------------------
DYRKP-1_Smoe_DYRKP     ------------------------------------------------------------
PRP4_e_Smoe_PRP4       ------------------------------------------------------------
PRP4_d_Smoe_PRP4       ------------------------------------------------------------
PRP4_b_Smoe_PRP4       ------------------------------------------------------------
PRP4_a_Smoe_PRP4       ------------------------------------------------------------
PRP4_c_Smoe_PRP4       ------------------------------------------------------------
YAK_b_Smoe_YAK         ------------------------------------------------------------
YAK_a_Smoe_YAK         ------------------------------------------------------------
YAK_d_Smoe_YAK         ------------------------------------------------------------
GK031_Glam_DYRK1       ------------------------------------------------------------
GK034_Glam_DYRK2       ------------------------------------------------------------
GK033_Glam_DYRK2       ------------------------------------------------------------
GK032_Glam_DYRK2       ------------------------------------------------------------


PRP4_Hsap_PRP4         ------------------------------------------------------------
HIPK4_Hsap_HIPK        ------------------------------------------------------------
HIPK3_Hsap_HIPK        ------------------------------------------------------------
HIPK2_Hsap_HIPK        ------------------------------------------------------------
HIPK1_Hsap_HIPK        ------------------------------------------------------------
smi35A_Dmel_DYRK2      ------------------------------------------------------------
mnb_Dmel_DYRK1         ------------------------------------------------------------
Dyrk3_Dmel_DYRK2       ------------------------------------------------------------
CG17090_Dmel_HIPK      ------------------------------------------------------------
PRP4_Mmus_PRP4         ------------------------------------------------------------
HIPK4_Mmus_HIPK        ------------------------------------------------------------
HIPK3_Mmus_HIPK        ------------------------------------------------------------
HIPK2_Mmus_HIPK        ------------------------------------------------------------
HIPK1_Mmus_HIPK        ------------------------------------------------------------
DYRK4_Mmus_DYRK2       ------------------------------------------------------------
DYRK3_Mmus_DYRK2       ------------------------------------------------------------
DYRK2_Mmus_DYRK2       ------------------------------------------------------------
DYRK1B_Mmus_DYRK1      ------------------------------------------------------------
DYRK1A_Mmus_DYRK1      ------------------------------------------------------------
mbk-2_Cele_DYRK2       ------------------------------------------------------------
mbk-1_Cele_DYRK1       ------------------------------------------------------------
hpk-1_Cele_HIPK        ------------------------------------------------------------
F22D6.5_Cele_PRP4      ------------------------------------------------------------
C36B7.2_Cele_DYRK2     ------------------------------------------------------------
C36B7.1_Cele_DYRK2     ------------------------------------------------------------
DYRK4_Hsap_DYRK2       ------------------------------------------------------------
DYRK3_Hsap_DYRK2       ------------------------------------------------------------
DYRK2_Hsap_DYRK2       ------------------------------------------------------------
DYRK1B_Hsap_DYRK1      ------------------------------------------------------------
DYRK1A_Hsap_DYRK1      ------------------------------------------------------------
YAK1_Scer_YAK          ------------------------------------------------------------
Dyrk1_Ddis_DYRK1       ------------------------------------------------------------
Dyrk2_Ddis_DYRK2       ------------------------------------------------------------
Prp4_Ddis_PRP4         ------------------------------------------------------------
YakA_Ddis_YAK          ------------------------------------------------------------
22349_Tthe_YAK         ------------------------------------------------------------
10580_Tthe_DyrkP       ------------------------------------------------------------
22423_Tthe_DyrkP       ------------------------------------------------------------
5306_Tthe_DYRK2        ------------------------------------------------------------
5356_Tthe_DYRK2        ------------------------------------------------------------
5655_Tthe_DYRK2        ------------------------------------------------------------
15575_Tthe_PRP4        ------------------------------------------------------------
DYRK1_Spur_DYRK1       ------------------------------------------------------------
DYRK2_Spur_DYRK2       ------------------------------------------------------------
DYRK4_Spur_DYRK2       ------------------------------------------------------------
HIPKa_Spur_HIPK        ------------------------------------------------------------
HIPKb_Spur_HIPK        ------------------------------------------------------------
PRP4_Spur_PRP4         MNLIAQGYQSDEEEGEDDESALKQSLSKWIRPESSSSKPSSKSELKDSERSEKRKRERED
CG7028_Dmel_PRP4       ------------------------------------------------------------
CC1G_13957_Ccin_DYRK2  ------------------------------------------------------------
CC1G_04865_Ccin_PRP4   ------------------------------------------------------------
CC1G_14245_Ccin_YAK    ------------------------------------------------------------
AqueK110_Aque_DYRK1    ------------------------------------------------------------
AqueK111_Aque_DYRK1    ------------------------------------------------------------
AqueK112_Aque_DYRK2    ------------------------------------------------------------
AqueK113_Aque_DYRK2    ------------------------------------------------------------
AqueK114_Aque_HIPK     ------------------------------------------------------------
AqueK115_Aque_PRP4     ------------------------------------------------------------
AqueK116_Aque_PRP4     ------------------------------------------------------------
DYRK2_b_Smoe_DYRK2     ------------------------------------------------------------
DYRK2_a_Smoe_DYRK2     ------------------------------------------------------------
DYRKP-2_Smoe_DYRKP     ------------------------------------------------------------
DYRKP-1_Smoe_DYRKP     ------------------------------------------------------------
PRP4_e_Smoe_PRP4       ------------------------------------------------------------
PRP4_d_Smoe_PRP4       ------------------------------------------------------------
PRP4_b_Smoe_PRP4       ------------------------------------------------------------
PRP4_a_Smoe_PRP4       ------------------------------------------------------------
PRP4_c_Smoe_PRP4       ------------------------------------------------------------
YAK_b_Smoe_YAK         ------------------------------------------------------------
YAK_a_Smoe_YAK         ------------------------------------------------------------
YAK_d_Smoe_YAK         ------------------------------------------------------------
GK031_Glam_DYRK1       ------------------------------------------------------------
GK034_Glam_DYRK2       ------------------------------------------------------------
GK033_Glam_DYRK2       ------------------------------------------------------------
GK032_Glam_DYRK2       ------------------------------------------------------------


PRP4_Hsap_PRP4         ------------------------------------------------------------
HIPK4_Hsap_HIPK        ------------------------------------------------------------
HIPK3_Hsap_HIPK        ------------------------------------------------------------
HIPK2_Hsap_HIPK        ------------------------------------------------------------
HIPK1_Hsap_HIPK        ------------------------------------------------------------
smi35A_Dmel_DYRK2      ------------------------------------------------------------
mnb_Dmel_DYRK1         ------------------------------------------------------------
Dyrk3_Dmel_DYRK2       ------------------------------------------------------------
CG17090_Dmel_HIPK      ------------------------------------------------------------
PRP4_Mmus_PRP4         ------------------------------------------------------------
HIPK4_Mmus_HIPK        ------------------------------------------------------------
HIPK3_Mmus_HIPK        ------------------------------------------------------------
HIPK2_Mmus_HIPK        ------------------------------------------------------------
HIPK1_Mmus_HIPK        ------------------------------------------------------------
DYRK4_Mmus_DYRK2       ------------------------------------------------------------
DYRK3_Mmus_DYRK2       ------------------------------------------------------------
DYRK2_Mmus_DYRK2       ------------------------------------------------------------
DYRK1B_Mmus_DYRK1      ------------------------------------------------------------
DYRK1A_Mmus_DYRK1      ------------------------------------------------------------
mbk-2_Cele_DYRK2       ------------------------------------------------------------
mbk-1_Cele_DYRK1       ------------------------------------------------------------
hpk-1_Cele_HIPK        ------------------------------------------------------------
F22D6.5_Cele_PRP4      ------------------------------------------------------------
C36B7.2_Cele_DYRK2     ------------------------------------------------------------
C36B7.1_Cele_DYRK2     ------------------------------------------------------------
DYRK4_Hsap_DYRK2       ------------------------------------------------------------
DYRK3_Hsap_DYRK2       ------------------------------------------------------------
DYRK2_Hsap_DYRK2       ------------------------------------------------------------
DYRK1B_Hsap_DYRK1      ------------------------------------------------------------
DYRK1A_Hsap_DYRK1      ------------------------------------------------------------
YAK1_Scer_YAK          ------------------------------------------------------------
Dyrk1_Ddis_DYRK1       ------------------------------------------------------------
Dyrk2_Ddis_DYRK2       ------------------------------------------------------------
Prp4_Ddis_PRP4         ------------------------------------------------------------
YakA_Ddis_YAK          ------------------------------------------------------------
22349_Tthe_YAK         ------------------------------------------------------------
10580_Tthe_DyrkP       ------------------------------------------------------------
22423_Tthe_DyrkP       ------------------------------------------------------------
5306_Tthe_DYRK2        ------------------------------------------------------------
5356_Tthe_DYRK2        ------------------------------------------------------------
5655_Tthe_DYRK2        ------------------------------------------------------------
15575_Tthe_PRP4        ------------------------------------------------------------
DYRK1_Spur_DYRK1       ------------------------------------------------------------
DYRK2_Spur_DYRK2       ------------------------------------------------------------
DYRK4_Spur_DYRK2       ------------------------------------------------------------
HIPKa_Spur_HIPK        ------------------------------------------------------------
HIPKb_Spur_HIPK        ------------------------------------------------------------
PRP4_Spur_PRP4         ETSQKKQHRSKSPATERSSGSSRVDNGDAKSSQSRTNRDSHIASDRKHSKDSDSRRDSRK
CG7028_Dmel_PRP4       ------------------------------------------------------------
CC1G_13957_Ccin_DYRK2  ------------------------------------------------------------
CC1G_04865_Ccin_PRP4   ------------------------------------------------------------
CC1G_14245_Ccin_YAK    ------------------------------------------------------------
AqueK110_Aque_DYRK1    ------------------------------------------------------------
AqueK111_Aque_DYRK1    ------------------------------------------------------------
AqueK112_Aque_DYRK2    ------------------------------------------------------------
AqueK113_Aque_DYRK2    ------------------------------------------------------------
AqueK114_Aque_HIPK     ------------------------------------------------------------
AqueK115_Aque_PRP4     ------------------------------------------------------------
AqueK116_Aque_PRP4     ------------------------------------------------------------
DYRK2_b_Smoe_DYRK2     ------------------------------------------------------------
DYRK2_a_Smoe_DYRK2     ------------------------------------------------------------
DYRKP-2_Smoe_DYRKP     ------------------------------------------------------------
DYRKP-1_Smoe_DYRKP     ------------------------------------------------------------
PRP4_e_Smoe_PRP4       ------------------------------------------------------------
PRP4_d_Smoe_PRP4       ------------------------------------------------------------
PRP4_b_Smoe_PRP4       ------------------------------------------------------------
PRP4_a_Smoe_PRP4       ------------------------------------------------------------
PRP4_c_Smoe_PRP4       ------------------------------------------------------------
YAK_b_Smoe_YAK         ------------------------------------------------------------
YAK_a_Smoe_YAK         ------------------------------------------------------------
YAK_d_Smoe_YAK         ------------------------------------------------------------
GK031_Glam_DYRK1       ------------------------------------------------------------
GK034_Glam_DYRK2       ------------------------------------------------------------
GK033_Glam_DYRK2       ------------------------------------------------------------
GK032_Glam_DYRK2       ------------------------------------------------------------


PRP4_Hsap_PRP4         ------------------------------------------------------------
HIPK4_Hsap_HIPK        ------------------------------------------------------------
HIPK3_Hsap_HIPK        ------------------------------------------------------------
HIPK2_Hsap_HIPK        ------------------------------------------------------------
HIPK1_Hsap_HIPK        ------------------------------------------------------------
smi35A_Dmel_DYRK2      ------------------------------------------------------------
mnb_Dmel_DYRK1         ------------------------------------------------------------
Dyrk3_Dmel_DYRK2       ------------------------------------------------------------
CG17090_Dmel_HIPK      ------------------------------------------------------------
PRP4_Mmus_PRP4         ------------------------------------------------------------
HIPK4_Mmus_HIPK        ------------------------------------------------------------
HIPK3_Mmus_HIPK        ------------------------------------------------------------
HIPK2_Mmus_HIPK        ------------------------------------------------------------
HIPK1_Mmus_HIPK        ------------------------------------------------------------
DYRK4_Mmus_DYRK2       ------------------------------------------------------------
DYRK3_Mmus_DYRK2       ------------------------------------------------------------
DYRK2_Mmus_DYRK2       ------------------------------------------------------------
DYRK1B_Mmus_DYRK1      ------------------------------------------------------------
DYRK1A_Mmus_DYRK1      ------------------------------------------------------------
mbk-2_Cele_DYRK2       ------------------------------------------------------------
mbk-1_Cele_DYRK1       ------------------------------------------------------------
hpk-1_Cele_HIPK        ------------------------------------------------------------
F22D6.5_Cele_PRP4      ------------------------------------------------------------
C36B7.2_Cele_DYRK2     ------------------------------------------------------------
C36B7.1_Cele_DYRK2     ------------------------------------------------------------
DYRK4_Hsap_DYRK2       ------------------------------------------------------------
DYRK3_Hsap_DYRK2       ------------------------------------------------------------
DYRK2_Hsap_DYRK2       ------------------------------------------------------------
DYRK1B_Hsap_DYRK1      ------------------------------------------------------------
DYRK1A_Hsap_DYRK1      ------------------------------------------------------------
YAK1_Scer_YAK          ------------------------------------------------------------
Dyrk1_Ddis_DYRK1       ------------------------------------------------------------
Dyrk2_Ddis_DYRK2       ------------------------------------------------------------
Prp4_Ddis_PRP4         ------------------------------------------------------------
YakA_Ddis_YAK          ------------------------------------------------------------
22349_Tthe_YAK         ------------------------------------------------------------
10580_Tthe_DyrkP       ------------------------------------------------------------
22423_Tthe_DyrkP       ------------------------------------------------------------
5306_Tthe_DYRK2        ------------------------------------------------------------
5356_Tthe_DYRK2        ------------------------------------------------------------
5655_Tthe_DYRK2        ------------------------------------------------------------
15575_Tthe_PRP4        ------------------------------------------------------------
DYRK1_Spur_DYRK1       ------------------------------------------------------------
DYRK2_Spur_DYRK2       ------------------------------------------------------------
DYRK4_Spur_DYRK2       ------------------------------------------------------------
HIPKa_Spur_HIPK        ------------------------------------------------------------
HIPKb_Spur_HIPK        ------------------------------------------------------------
PRP4_Spur_PRP4         SSPSATKSEQRESRDSREPRDSRKSSGRDGRASPKRELKSGEKSRRESSRDSKPIRSRSP
CG7028_Dmel_PRP4       ------------------------------------------------------------
CC1G_13957_Ccin_DYRK2  ------------------------------------------------------------
CC1G_04865_Ccin_PRP4   ------------------------------------------------------------
CC1G_14245_Ccin_YAK    ------------------------------------------------------------
AqueK110_Aque_DYRK1    ------------------------------------------------------------
AqueK111_Aque_DYRK1    ------------------------------------------------------------
AqueK112_Aque_DYRK2    ------------------------------------------------------------
AqueK113_Aque_DYRK2    ------------------------------------------------------------
AqueK114_Aque_HIPK     ------------------------------------------------------------
AqueK115_Aque_PRP4     ------------------------------------------------------------
AqueK116_Aque_PRP4     ------------------------------------------------------------
DYRK2_b_Smoe_DYRK2     ------------------------------------------------------------
DYRK2_a_Smoe_DYRK2     ------------------------------------------------------------
DYRKP-2_Smoe_DYRKP     ------------------------------------------------------------
DYRKP-1_Smoe_DYRKP     ------------------------------------------------------------
PRP4_e_Smoe_PRP4       ------------------------------------------------------------
PRP4_d_Smoe_PRP4       ------------------------------------------------------------
PRP4_b_Smoe_PRP4       ------------------------------------------------------------
PRP4_a_Smoe_PRP4       -----------------------------GRVDDAKDKSRKRKSVEDEQPSSKRREDDDG
PRP4_c_Smoe_PRP4       ------------------------------------------------------------
YAK_b_Smoe_YAK         ------------------------------------------------------------
YAK_a_Smoe_YAK         ------------------------------------------------------------
YAK_d_Smoe_YAK         ------------------------------------------------------------
GK031_Glam_DYRK1       ------------------------------------------------------------
GK034_Glam_DYRK2       ------------------------------------------------------------
GK033_Glam_DYRK2       ------------------------------------------------------------
GK032_Glam_DYRK2       ------------------------------------------------------------


PRP4_Hsap_PRP4         ------------------------------------------------------------
HIPK4_Hsap_HIPK        ------------------------------------------------------------
HIPK3_Hsap_HIPK        ------------------------------------------------------------
HIPK2_Hsap_HIPK        ------------------------------------------------------------
HIPK1_Hsap_HIPK        ------------------------------------------------------------
smi35A_Dmel_DYRK2      ------------------------------------------------------------
mnb_Dmel_DYRK1         ------------------------------------------------------------
Dyrk3_Dmel_DYRK2       ------------------------------------------------------------
CG17090_Dmel_HIPK      ------------------------------------------------------------
PRP4_Mmus_PRP4         ------------------------------------------------------------
HIPK4_Mmus_HIPK        ------------------------------------------------------------
HIPK3_Mmus_HIPK        ------------------------------------------------------------
HIPK2_Mmus_HIPK        ------------------------------------------------------------
HIPK1_Mmus_HIPK        ------------------------------------------------------------
DYRK4_Mmus_DYRK2       ------------------------------------------------------------
DYRK3_Mmus_DYRK2       ------------------------------------------------------------
DYRK2_Mmus_DYRK2       ------------------------------------------------------------
DYRK1B_Mmus_DYRK1      ------------------------------------------------------------
DYRK1A_Mmus_DYRK1      ------------------------------------------------------------
mbk-2_Cele_DYRK2       ------------------------------------------------------------
mbk-1_Cele_DYRK1       ------------------------------------------------------------
hpk-1_Cele_HIPK        ------------------------------------------------------------
F22D6.5_Cele_PRP4      ------------------------------------------------------------
C36B7.2_Cele_DYRK2     ------------------------------------------------------------
C36B7.1_Cele_DYRK2     ------------------------------------------------------------
DYRK4_Hsap_DYRK2       ------------------------------------------------------------
DYRK3_Hsap_DYRK2       ------------------------------------------------------------
DYRK2_Hsap_DYRK2       ------------------------------------------------------------
DYRK1B_Hsap_DYRK1      ------------------------------------------------------------
DYRK1A_Hsap_DYRK1      ------------------------------------------------------------
YAK1_Scer_YAK          ------------------------------------------------------------
Dyrk1_Ddis_DYRK1       ------------------------------------------------------------
Dyrk2_Ddis_DYRK2       ------------------------------------------------------------
Prp4_Ddis_PRP4         ------------------------------------------------------------
YakA_Ddis_YAK          ------------------------------------------------------------
22349_Tthe_YAK         ------------------------------------------------------------
10580_Tthe_DyrkP       ------------------------------------------------------------
22423_Tthe_DyrkP       ------------------------------------------------------------
5306_Tthe_DYRK2        ------------------------------------------------------------
5356_Tthe_DYRK2        ------------------------------------------------------------
5655_Tthe_DYRK2        ------------------------------------------------------------
15575_Tthe_PRP4        ------------------------------------------------------------
DYRK1_Spur_DYRK1       ------------------------------------------------------------
DYRK2_Spur_DYRK2       ------------------------------------------------------------
DYRK4_Spur_DYRK2       ------------------------------------------------------------
HIPKa_Spur_HIPK        ------------------------------------------------------------
HIPKb_Spur_HIPK        ------------------------------------------------------------
PRP4_Spur_PRP4         KKERVFTEPARSRPSPPRRSPPPRRPPSPPARRPDQPLGRRGRSPIERRGRSPLERRIRS
CG7028_Dmel_PRP4       ------------------------------------------------------------
CC1G_13957_Ccin_DYRK2  ------------------------------------------------------------
CC1G_04865_Ccin_PRP4   ------------------------------------------------------------
CC1G_14245_Ccin_YAK    ------------------------------------------------------------
AqueK110_Aque_DYRK1    ------------------------------------------------------------
AqueK111_Aque_DYRK1    ------------------------------------------------------------
AqueK112_Aque_DYRK2    ------------------------------------------------------------
AqueK113_Aque_DYRK2    ------------------------------------------------------------
AqueK114_Aque_HIPK     ------------------------------------------------------------
AqueK115_Aque_PRP4     ------------------------------------------------------------
AqueK116_Aque_PRP4     ------------------------------------------------------------
DYRK2_b_Smoe_DYRK2     ------------------------------------------------------------
DYRK2_a_Smoe_DYRK2     ------------------------------------------------------------
DYRKP-2_Smoe_DYRKP     ------------------------------------------------------------
DYRKP-1_Smoe_DYRKP     ------------------------------------------------------------
PRP4_e_Smoe_PRP4       ------------------------------------------------------------
PRP4_d_Smoe_PRP4       ------------------------------------------------------------
PRP4_b_Smoe_PRP4       ------------------------------------------------------------
PRP4_a_Smoe_PRP4       KRKHKHRKHKHRSSHRKHISKEVDLDVVPAAMACEAEDGEILEPTEDGIVLKEEGNGSSE
PRP4_c_Smoe_PRP4       ------------------------------------------------------------
YAK_b_Smoe_YAK         ------------------------------------------------------------
YAK_a_Smoe_YAK         ------------------------------------------------------------
YAK_d_Smoe_YAK         ------------------------------------------------------------
GK031_Glam_DYRK1       ------------------------------------------------------------
GK034_Glam_DYRK2       ------------------------------------------------------------
GK033_Glam_DYRK2       ------------------------------------------------------------
GK032_Glam_DYRK2       ------------------------------------------------------------


PRP4_Hsap_PRP4         ------------------------------------------------------------
HIPK4_Hsap_HIPK        ------------------------------------------------------------
HIPK3_Hsap_HIPK        ------------------------------------------------------------
HIPK2_Hsap_HIPK        ------------------------------------------------------------
HIPK1_Hsap_HIPK        ------------------------------------------------------------
smi35A_Dmel_DYRK2      ------------------------------------------------------------
mnb_Dmel_DYRK1         ------------------------------------------------------------
Dyrk3_Dmel_DYRK2       ------------------------------------------------------------
CG17090_Dmel_HIPK      ------------------------------------------------------------
PRP4_Mmus_PRP4         ------------------------------------------------------------
HIPK4_Mmus_HIPK        ------------------------------------------------------------
HIPK3_Mmus_HIPK        ------------------------------------------------------------
HIPK2_Mmus_HIPK        ------------------------------------------------------------
HIPK1_Mmus_HIPK        ------------------------------------------------------------
DYRK4_Mmus_DYRK2       ------------------------------------------------------------
DYRK3_Mmus_DYRK2       ------------------------------------------------------------
DYRK2_Mmus_DYRK2       ------------------------------------------------------------
DYRK1B_Mmus_DYRK1      ------------------------------------------------------------
DYRK1A_Mmus_DYRK1      ------------------------------------------------------------
mbk-2_Cele_DYRK2       ------------------------------------------------------------
mbk-1_Cele_DYRK1       ------------------------------------------------------------
hpk-1_Cele_HIPK        ------------------------------------------------------------
F22D6.5_Cele_PRP4      ------------------------------------------------------------
C36B7.2_Cele_DYRK2     ------------------------------------------------------------
C36B7.1_Cele_DYRK2     ------------------------------------------------------------
DYRK4_Hsap_DYRK2       ------------------------------------------------------------
DYRK3_Hsap_DYRK2       ------------------------------------------------------------
DYRK2_Hsap_DYRK2       ------------------------------------------------------------
DYRK1B_Hsap_DYRK1      ------------------------------------------------------------
DYRK1A_Hsap_DYRK1      ------------------------------------------------------------
YAK1_Scer_YAK          ------------------------------------------------------------
Dyrk1_Ddis_DYRK1       ------------------------------------------------------------
Dyrk2_Ddis_DYRK2       ------------------------------------------------------------
Prp4_Ddis_PRP4         ------------------------------------------------------------
YakA_Ddis_YAK          ------------------------------------------------------------
22349_Tthe_YAK         ------------------------------------------------------------
10580_Tthe_DyrkP       ------------------------------------------------------------
22423_Tthe_DyrkP       ------------------------------------------------------------
5306_Tthe_DYRK2        ------------------------------------------------------------
5356_Tthe_DYRK2        ------------------------------------------------------------
5655_Tthe_DYRK2        ------------------------------------------------------------
15575_Tthe_PRP4        ------------------------------------------------------------
DYRK1_Spur_DYRK1       ------------------------------------------------------------
DYRK2_Spur_DYRK2       ------------------------------------------------------------
DYRK4_Spur_DYRK2       ------------------------------------------------------------
HIPKa_Spur_HIPK        ------------------------------------------------------------
HIPKb_Spur_HIPK        ------------------------------------------------------------
PRP4_Spur_PRP4         SRSPAVVDRFDRRRGASPPRRFGDMSRNRRRWSRSPDRRGRRGRWGRSRSKSPRDKFKGS
CG7028_Dmel_PRP4       ------------------------------------------------------------
CC1G_13957_Ccin_DYRK2  ------------------------------------------------------------
CC1G_04865_Ccin_PRP4   ------------------------------------------------------------
CC1G_14245_Ccin_YAK    ------------------------------------------------------------
AqueK110_Aque_DYRK1    ------------------------------------------------------------
AqueK111_Aque_DYRK1    ------------------------------------------------------------
AqueK112_Aque_DYRK2    ------------------------------------------------------------
AqueK113_Aque_DYRK2    ------------------------------------------------------------
AqueK114_Aque_HIPK     ------------------------------------------------------------
AqueK115_Aque_PRP4     ------------------------------------------------------------
AqueK116_Aque_PRP4     ------------------------------------------------------------
DYRK2_b_Smoe_DYRK2     ------------------------------------------------------------
DYRK2_a_Smoe_DYRK2     ------------------------------------------------------------
DYRKP-2_Smoe_DYRKP     ------------------------------------------------------------
DYRKP-1_Smoe_DYRKP     ------------------------------------------------------------
PRP4_e_Smoe_PRP4       ------------------------------------------------------------
PRP4_d_Smoe_PRP4       ------------------------------------------------------------
PRP4_b_Smoe_PRP4       ------------------------------------------------------------
PRP4_a_Smoe_PRP4       SEKDVEQEIEAPKSERGSPRRSRDGSPPRDNVDRKHSSPDRRHRGSSVDRKRRSRSKESV
PRP4_c_Smoe_PRP4       ------------------------------------------------------------
YAK_b_Smoe_YAK         ------------------------------------------------------------
YAK_a_Smoe_YAK         ------------------------------------------------------------
YAK_d_Smoe_YAK         ------------------------------------------------------------
GK031_Glam_DYRK1       ------------------------------------------------------------
GK034_Glam_DYRK2       ------------------------------------------------------------
GK033_Glam_DYRK2       ------------------------------------------------------------
GK032_Glam_DYRK2       ------------------------------------------------------------


PRP4_Hsap_PRP4         ------------------------------------------------------------
HIPK4_Hsap_HIPK        ------------------------------------------------------------
HIPK3_Hsap_HIPK        ------------------------------------------------------------
HIPK2_Hsap_HIPK        ------------------------------------------------------------
HIPK1_Hsap_HIPK        ------------------------------------------------------------
smi35A_Dmel_DYRK2      ------------------------------------------------------------
mnb_Dmel_DYRK1         ------------------------------------------------------------
Dyrk3_Dmel_DYRK2       ------------------------------------------------------------
CG17090_Dmel_HIPK      ------------------------------------------------------------
PRP4_Mmus_PRP4         ------------------------------------------------------------
HIPK4_Mmus_HIPK        ------------------------------------------------------------
HIPK3_Mmus_HIPK        ------------------------------------------------------------
HIPK2_Mmus_HIPK        ------------------------------------------------------------
HIPK1_Mmus_HIPK        ------------------------------------------------------------
DYRK4_Mmus_DYRK2       ------------------------------------------------------------
DYRK3_Mmus_DYRK2       ------------------------------------------------------------
DYRK2_Mmus_DYRK2       ------------------------------------------------------------
DYRK1B_Mmus_DYRK1      ------------------------------------------------------------
DYRK1A_Mmus_DYRK1      ------------------------------------------------------------
mbk-2_Cele_DYRK2       ------------------------------------------------------------
mbk-1_Cele_DYRK1       ------------------------------------------------------------
hpk-1_Cele_HIPK        ------------------------------------------------------------
F22D6.5_Cele_PRP4      ------------------------------------------------------------
C36B7.2_Cele_DYRK2     ------------------------------------------------------------
C36B7.1_Cele_DYRK2     ------------------------------------------------------------
DYRK4_Hsap_DYRK2       ------------------------------------------------------------
DYRK3_Hsap_DYRK2       ------------------------------------------------------------
DYRK2_Hsap_DYRK2       ------------------------------------------------------------
DYRK1B_Hsap_DYRK1      ------------------------------------------------------------
DYRK1A_Hsap_DYRK1      ------------------------------------------------------------
YAK1_Scer_YAK          ------------------------------------------------------------
Dyrk1_Ddis_DYRK1       ------------------------------------------------------------
Dyrk2_Ddis_DYRK2       ------------------------------------------------------------
Prp4_Ddis_PRP4         ------------------------------------------------------------
YakA_Ddis_YAK          ------------------------------------------------------------
22349_Tthe_YAK         ------------------------------------------------------------
10580_Tthe_DyrkP       ------------------------------------------------------------
22423_Tthe_DyrkP       ------------------------------------------------------------
5306_Tthe_DYRK2        ------------------------------------------------------------
5356_Tthe_DYRK2        ------------------------------------------------------------
5655_Tthe_DYRK2        ------------------------------------------------------------
15575_Tthe_PRP4        ------------------------------------------------------------
DYRK1_Spur_DYRK1       ------------------------------------------------------------
DYRK2_Spur_DYRK2       ------------------------------------------------------------
DYRK4_Spur_DYRK2       ------------------------------------------------------------
HIPKa_Spur_HIPK        ------------------------------------------------------------
HIPKb_Spur_HIPK        ------------------------------------------------------------
PRP4_Spur_PRP4         LSEGLSLKQESSDDEIPDVDLDEEEDEEAVIERRRRERQQLMQKYKVAPAESATSSPAQG
CG7028_Dmel_PRP4       ------------------------------------------------------------
CC1G_13957_Ccin_DYRK2  ------------------------------------------------------------
CC1G_04865_Ccin_PRP4   ------------------------------------------------------------
CC1G_14245_Ccin_YAK    ------------------------------------------------------------
AqueK110_Aque_DYRK1    ------------------------------------------------------------
AqueK111_Aque_DYRK1    ------------------------------------------------------------
AqueK112_Aque_DYRK2    ------------------------------------------------------------
AqueK113_Aque_DYRK2    ------------------------------------------------------------
AqueK114_Aque_HIPK     ------------------------------------------------------------
AqueK115_Aque_PRP4     ------------------------------------------------------------
AqueK116_Aque_PRP4     ------------------------------------------------------------
DYRK2_b_Smoe_DYRK2     ------------------------------------------------------------
DYRK2_a_Smoe_DYRK2     ------------------------------------------------------------
DYRKP-2_Smoe_DYRKP     ------------------------------------------------------------
DYRKP-1_Smoe_DYRKP     ------------------------------------------------------------
PRP4_e_Smoe_PRP4       ------------------------------------------------------------
PRP4_d_Smoe_PRP4       ------------------------------------------------------------
PRP4_b_Smoe_PRP4       ------------------------------------------------------------
PRP4_a_Smoe_PRP4       RENARHHSRVASPDRKRRRSRSRDRGDERSRRHAYSPDRRRRSRSREHDEREKYPRKRAE
PRP4_c_Smoe_PRP4       ------------------------------------------------------------
YAK_b_Smoe_YAK         ------------------------------------------------------------
YAK_a_Smoe_YAK         ------------------------------------------------------------
YAK_d_Smoe_YAK         ------------------------------------------------------------
GK031_Glam_DYRK1       ------------------------------------------------------------
GK034_Glam_DYRK2       ------------------------------------------------------------
GK033_Glam_DYRK2       ------------------------------------------------------------
GK032_Glam_DYRK2       ------------------------------------------------------------


PRP4_Hsap_PRP4         ------------------------------------------------------------
HIPK4_Hsap_HIPK        ------------------------------------------------------------
HIPK3_Hsap_HIPK        ------------------------------------------------------------
HIPK2_Hsap_HIPK        ------------------------------------------------------------
HIPK1_Hsap_HIPK        ------------------------------------------------------------
smi35A_Dmel_DYRK2      ------------------------------------------------------------
mnb_Dmel_DYRK1         ------------------------------------------------------------
Dyrk3_Dmel_DYRK2       ------------------------------------------------------------
CG17090_Dmel_HIPK      ------------------------------------------------------------
PRP4_Mmus_PRP4         ------------------------------------------------------------
HIPK4_Mmus_HIPK        ------------------------------------------------------------
HIPK3_Mmus_HIPK        ------------------------------------------------------------
HIPK2_Mmus_HIPK        ------------------------------------------------------------
HIPK1_Mmus_HIPK        ------------------------------------------------------------
DYRK4_Mmus_DYRK2       ------------------------------------------------------------
DYRK3_Mmus_DYRK2       ------------------------------------------------------------
DYRK2_Mmus_DYRK2       ------------------------------------------------------------
DYRK1B_Mmus_DYRK1      ------------------------------------------------------------
DYRK1A_Mmus_DYRK1      ------------------------------------------------------------
mbk-2_Cele_DYRK2       ------------------------------------------------------------
mbk-1_Cele_DYRK1       ------------------------------------------------------------
hpk-1_Cele_HIPK        ------------------------------------------------------------
F22D6.5_Cele_PRP4      ------------------------------------------------------------
C36B7.2_Cele_DYRK2     ------------------------------------------------------------
C36B7.1_Cele_DYRK2     ------------------------------------------------------------
DYRK4_Hsap_DYRK2       ------------------------------------------------------------
DYRK3_Hsap_DYRK2       ------------------------------------------------------------
DYRK2_Hsap_DYRK2       ------------------------------------------------------------
DYRK1B_Hsap_DYRK1      ------------------------------------------------------------
DYRK1A_Hsap_DYRK1      ------------------------------------------------------------
YAK1_Scer_YAK          ------------------------------------------------------------
Dyrk1_Ddis_DYRK1       ------------------------------------------------------------
Dyrk2_Ddis_DYRK2       ------------------------------------------------------------
Prp4_Ddis_PRP4         ------------------------------------------------------------
YakA_Ddis_YAK          ------------------------------------------------------------
22349_Tthe_YAK         ------------------------------------------------------------
10580_Tthe_DyrkP       ------------------------------------------------------------
22423_Tthe_DyrkP       ------------------------------------------------------------
5306_Tthe_DYRK2        ------------------------------------------------------------
5356_Tthe_DYRK2        ------------------------------------------------------------
5655_Tthe_DYRK2        ------------------------------------------------------------
15575_Tthe_PRP4        ------------------------------------------------------------
DYRK1_Spur_DYRK1       ------------------------------------------------------------
DYRK2_Spur_DYRK2       ------------------------------------------------------------
DYRK4_Spur_DYRK2       ------------------------------------------------------------
HIPKa_Spur_HIPK        ------------------------------------------------------------
HIPKb_Spur_HIPK        ------------------------------------------------------------
PRP4_Spur_PRP4         PSEPSSTPQSPQASEQGGSTAQSQDTDDEDDDEEEEEEDEEEDDSEKSSSSDSDDDSSEV
CG7028_Dmel_PRP4       ------------------------------------------------------------
CC1G_13957_Ccin_DYRK2  ------------------------------------------------------------
CC1G_04865_Ccin_PRP4   ------------------------------------------------------------
CC1G_14245_Ccin_YAK    ------------------------------------------------------------
AqueK110_Aque_DYRK1    ------------------------------------------------------------
AqueK111_Aque_DYRK1    ------------------------------------------------------------
AqueK112_Aque_DYRK2    ------------------------------------------------------------
AqueK113_Aque_DYRK2    ------------------------------------------------------------
AqueK114_Aque_HIPK     ------------------------------------------------------------
AqueK115_Aque_PRP4     ------------------------------------------------------------
AqueK116_Aque_PRP4     ------------------------------------------------------------
DYRK2_b_Smoe_DYRK2     ------------------------------------------------------------
DYRK2_a_Smoe_DYRK2     ------------------------------------------------------------
DYRKP-2_Smoe_DYRKP     ------------------------------------------------------------
DYRKP-1_Smoe_DYRKP     ------------------------------------------------------------
PRP4_e_Smoe_PRP4       ------------------------------------------------------------
PRP4_d_Smoe_PRP4       ------------------------------------------------------------
PRP4_b_Smoe_PRP4       ------------------------------------------------------------
PRP4_a_Smoe_PRP4       SRDRHIKDDRGARDDERHYNRDRNRRDREELSEKQETTQSETIEREEENQDEYLERVAHQ
PRP4_c_Smoe_PRP4       ------------------------------------------------------------
YAK_b_Smoe_YAK         ------------------------------------------------------------
YAK_a_Smoe_YAK         ------------------------------------------------------------
YAK_d_Smoe_YAK         ------------------------------------------------------------
GK031_Glam_DYRK1       ------------------------------------------------------------
GK034_Glam_DYRK2       ------------------------------------------------------------
GK033_Glam_DYRK2       ------------------------------------------------------------
GK032_Glam_DYRK2       ------------------------------------------------------------


PRP4_Hsap_PRP4         ------------------------------------------------------------
HIPK4_Hsap_HIPK        ------------------------------------------------------------
HIPK3_Hsap_HIPK        ------------------------------------------------------------
HIPK2_Hsap_HIPK        ------------------------------------------------------------
HIPK1_Hsap_HIPK        ------------------------------------------------------------
smi35A_Dmel_DYRK2      ------------------------------------------------------------
mnb_Dmel_DYRK1         ------------------------------------------------------------
Dyrk3_Dmel_DYRK2       ------------------------------------------------------------
CG17090_Dmel_HIPK      ------------------------------------------------------------
PRP4_Mmus_PRP4         ------------------------------------------------------------
HIPK4_Mmus_HIPK        ------------------------------------------------------------
HIPK3_Mmus_HIPK        ------------------------------------------------------------
HIPK2_Mmus_HIPK        ------------------------------------------------------------
HIPK1_Mmus_HIPK        ------------------------------------------------------------
DYRK4_Mmus_DYRK2       ------------------------------------------------------------
DYRK3_Mmus_DYRK2       ------------------------------------------------------------
DYRK2_Mmus_DYRK2       ------------------------------------------------------------
DYRK1B_Mmus_DYRK1      ------------------------------------------------------------
DYRK1A_Mmus_DYRK1      ------------------------------------------------------------
mbk-2_Cele_DYRK2       ------------------------------------------------------------
mbk-1_Cele_DYRK1       ------------------------------------------------------------
hpk-1_Cele_HIPK        ------------------------------------------------------------
F22D6.5_Cele_PRP4      ------------------------------------------------------------
C36B7.2_Cele_DYRK2     ------------------------------------------------------------
C36B7.1_Cele_DYRK2     ------------------------------------------------------------
DYRK4_Hsap_DYRK2       ------------------------------------------------------------
DYRK3_Hsap_DYRK2       ------------------------------------------------------------
DYRK2_Hsap_DYRK2       ------------------------------------------------------------
DYRK1B_Hsap_DYRK1      ------------------------------------------------------------
DYRK1A_Hsap_DYRK1      ------------------------------------------------------------
YAK1_Scer_YAK          ------------------------------------------------------------
Dyrk1_Ddis_DYRK1       ------------------------------------------------------------
Dyrk2_Ddis_DYRK2       ------------------------------------------------------------
Prp4_Ddis_PRP4         ------------------------------------------------------------
YakA_Ddis_YAK          ---------------------------------------------------