Protein (view, download) , Domain (view, download)
PRP4_Hsap_PRP4         MAAAETQSL--RE-QPE----------------------M---------ED---------
HIPK4_Hsap_HIPK        MSTIQ-------------------------------------------------------
HIPK3_Hsap_HIPK        MASQVLVY-------------------------------P---------PY-----V---
HIPK2_Hsap_HIPK        MAPVYEGMA--SH-VQVF---------------------S---------PH-----T---
HIPK1_Hsap_HIPK        MASQLQVF-------------------------------S---------PP-----S---
smi35A_Dmel_DYRK2      MLDRCEMPI--Q--------------------------------------L-----D---
mnb_Dmel_DYRK1         MHHHSSPSS--SS-E---------------------------------------------
Dyrk3_Dmel_DYRK2       MINQNLTHT--GI-AQN--------------------------------NT-----E---
CG17090_Dmel_HIPK      MKTSYPPKA--SD-FVDY---------------------A----------------V---
PRP4_Mmus_PRP4         MAATEPPSL--RE-QAE----------------------M---------DD---------
HIPK4_Mmus_HIPK        MATIQ-------------------------------------------------------
HIPK3_Mmus_HIPK        MASQVLVY-------------------------------P---------PY-----V---
HIPK2_Mmus_HIPK        MAPVYEGMA--SH-VQVF---------------------S---------PH-----T---
HIPK1_Mmus_HIPK        MASQLQVF-------------------------------S---------PP-----S---
DYRK4_Mmus_DYRK2       MQLLRLPAL--TR-TET--------------------------------SM-----D---
DYRK3_Mmus_DYRK2       MGGAARDRG--RK-DAA--------------------------------LP-----G---
DYRK2_Mmus_DYRK2       MLTRKPSAA--AP-AAY--------------------------------PT-----G---
DYRK1B_Mmus_DYRK1      MAVPPGHGP--FS-----------------------------------------------
DYRK1A_Mmus_DYRK1      MHTGGETSA--CK-P-----------------------------------S-----S---
mbk-2_Cele_DYRK2       MAALASFTR--NS-RSY----------------------GQQ-------PIDVTQ-Q---
mbk-1_Cele_DYRK1       MFPTLSSVV--ES-AAC----------------------R---------VA-----C---
hpk-1_Cele_HIPK        MNFHFTLDN--DR-KRR-------------------------------------------
F22D6.5_Cele_PRP4      MEDNRVEED--GE-VKS----------------------D---------VG---------
C36B7.2_Cele_DYRK2     MADIQRHFS--NL-VIGA---------------------S--------------------
C36B7.1_Cele_DYRK2     MSLLIKSVQ--IV-KLH-------------------------------------------
DYRK4_Hsap_DYRK2       MQLLPPPIR--TG-TKT--------------------------------QM-----D---
DYRK3_Hsap_DYRK2       MGGTARGPG--RK-DAG--------------------------------PP-----G---
DYRK2_Hsap_DYRK2       MLTRKPSAA--AP-AAY--------------------------------PT-----G---
DYRK1B_Hsap_DYRK1      MAVPPGHGP--FS-----------------------------------------------
DYRK1A_Hsap_DYRK1      MHTGGETSA--CK-P-----------------------------------S-----S---
YAK1_Scer_YAK          MNSSNNNDS--SS-SNS----------------------N---------MN---------
Dyrk1_Ddis_DYRK1       MDSDAKSRN--DA--PI----------------------I--------------------
Dyrk2_Ddis_DYRK2       MTSLHKQII--ES-H----------------------------------NN-----D---
Prp4_Ddis_PRP4         MVIESEIND--KK-RGL----------------------E---------SS-----S---
YakA_Ddis_YAK          MGSTTQMSD--YL-VST----------------------T---------TT---------
22349_Tthe_YAK         MKRCNQEFK--FD-QSL----------------------I---------PR---------
10580_Tthe_DyrkP       MPSFIKPKQ--ND-VS-----------------------D----------F-----F---
22423_Tthe_DyrkP       MLETCGQLM--NF-LNQA---------------------G----------L-----M---
5306_Tthe_DYRK2        MYIFNTFIQFCSQ-TKEA---------------------EKVQSTRNSFAIDQKNKDSIL
5356_Tthe_DYRK2        MQFYNPNSS--SS-ASK----------------------NSNI------KVQ-----QNL
5655_Tthe_DYRK2        MHNNSSANN--SF-NNE----------------------QALLS-----TVDLASQDISA
15575_Tthe_PRP4        MSDKQKKKE--DGELSG----------------------E---------ED-----E---
DYRK1_Spur_DYRK1       MTIDHVRHY--RLYM-----------------------------------Q-----H---
DYRK2_Spur_DYRK2       MVDSMVDAI--AR-KPN---------------------------------L-----Q---
DYRK4_Spur_DYRK2       MPACLHGVA--SM-G---------------------------------------------
HIPKa_Spur_HIPK        LYPPF---------------------------------------------------I---
HIPKb_Spur_HIPK        ------------------------------------------------------------
PRP4_Spur_PRP4         MSSNSASEE--EN-VKG----------------------G---------AP---------
CG7028_Dmel_PRP4       MADDKSYDS--SN-NSE----------------------T---------EE---------
CC1G_13957_Ccin_DYRK2  MSASPDPPQ--QY-K----------------------------------A----------
CC1G_04865_Ccin_PRP4   MADASPAPV--EE-PEE----------------------E---------TA---------
CC1G_14245_Ccin_YAK    MQDSNESSF--DL-PRW---------------------------------Q---------
AqueK110_Aque_DYRK1    MSKI--------------------------------------------------------
AqueK111_Aque_DYRK1    MDGSSSDSS--LQ-Q---------------------------------------------
AqueK112_Aque_DYRK2    MERGTGSTK--ER-S---------------------------------------------
AqueK113_Aque_DYRK2    MLAMYNSQS--LT-SAN-------------------------------------------
AqueK114_Aque_HIPK     MALEQQRV-----------------------------------------PL-----G---
AqueK115_Aque_PRP4     ------------------------------------------------------------
AqueK116_Aque_PRP4     MDSCIFVIM--AE-RKL----------------------S---------TG---------
DYRK2_b_Smoe_DYRK2     MAQTDRSAY--AD-----------------------------------------------
DYRK2_a_Smoe_DYRK2     MAQTDRSAY--AD-----------------------------------------------
DYRKP-2_Smoe_DYRKP     M-----------------------------------------------------------
DYRKP-1_Smoe_DYRKP     MADTVGSIL--DY-LRQH---------------------H----------F-----L---
PRP4_e_Smoe_PRP4       MGRKRRSED--CQ-ISV----------------------V---------ED---------
PRP4_d_Smoe_PRP4       MGRRKRSEN--YQ-IRV----------------------E---------ED---------
PRP4_b_Smoe_PRP4       MARDGRVDD--AK-D------------------------K---------SR-----K---
PRP4_a_Smoe_PRP4       MARDGRVDD--AK-D------------------------K---------SR-----K---
PRP4_c_Smoe_PRP4       MFSETPLTE---------------------------------------------------
YAK_b_Smoe_YAK         RL---T------------------------------------------------------
YAK_a_Smoe_YAK         ICVRLT------------------------------------------------------
YAK_d_Smoe_YAK         MYVSDQ------------------------------------------------------
GK031_Glam_DYRK1       MSGRPIIAL--TL-DIE-------------------------------------------
GK034_Glam_DYRK2       MFAPGNSAR--AQ-R-----------------------------------Q-----V---
GK033_Glam_DYRK2       MDTITLIAG--FL-R-----------------------------------Q-----H---
GK032_Glam_DYRK2       MIQPEALHQ---L-IYDHVYVKYGHQLAFTIRALLNAKER----------C-----M---


PRP4_Hsap_PRP4         -------A--NS------------------------------------------------
HIPK4_Hsap_HIPK        ------------------------------------------------------------
HIPK3_Hsap_HIPK        YQ-----T-Q--------------------------------------------------
HIPK2_Hsap_HIPK        -------L-Q--------------------------------------------------
HIPK1_Hsap_HIPK        -------V-S--------------------------------------------------
smi35A_Dmel_DYRK2      -------N-E-KLRR---------------------------------------------
mnb_Dmel_DYRK1         -------V-R--------------------------------------------------
Dyrk3_Dmel_DYRK2       -------K-A-N------------------------------------------------
CG17090_Dmel_HIPK      AG-----G-G--------------------------------------------------
PRP4_Mmus_PRP4         -------A-DNS------------------------------------------------
HIPK4_Mmus_HIPK        ------------------------------------------------------------
HIPK3_Mmus_HIPK        YQ-----T-Q--------------------------------------------------
HIPK2_Mmus_HIPK        -------L-Q--------------------------------------------------
HIPK1_Mmus_HIPK        -------V-S--------------------------------------------------
DYRK4_Mmus_DYRK2       -------T-N-KARK---------------------------------------------
DYRK3_Mmus_DYRK2       -------A-G-LPPQ---------------------------------------------
DYRK2_Mmus_DYRK2       -------R-G-G------------------------------------------------
DYRK1B_Mmus_DYRK1      ------------------------------------------------------------
DYRK1A_Mmus_DYRK1      -------V-R--------------------------------------------------
mbk-2_Cele_DYRK2       -------G-Q-R------------------------------------------------
mbk-1_Cele_DYRK1       -------P-RLS------------------------------------------------
hpk-1_Cele_HIPK        ------------------------------------------------------------
F22D6.5_Cele_PRP4      ---------TSS------------------------------------------------
C36B7.2_Cele_DYRK2     -P----------------------------------------------------------
C36B7.1_Cele_DYRK2     ------------------------------------------------------------
DYRK4_Hsap_DYRK2       -------A-K-KPRK---------------------------------------------
DYRK3_Hsap_DYRK2       -------A-G-LPPQ---------------------------------------------
DYRK2_Hsap_DYRK2       -------R-G-G------------------------------------------------
DYRK1B_Hsap_DYRK1      ------------------------------------------------------------
DYRK1A_Hsap_DYRK1      -------V-R--------------------------------------------------
YAK1_Scer_YAK          -------N-SLS------------------------------------------------
Dyrk1_Ddis_DYRK1       ------------------------------------------------------------
Dyrk2_Ddis_DYRK2       -------ITK--------------------------------------------------
Prp4_Ddis_PRP4         -------P-TIND-----------------------------------------------
YakA_Ddis_YAK          -------S-SA-------------------------------------------------
22349_Tthe_YAK         ------------------------------------------------------------
10580_Tthe_DyrkP       QN----------------------------------------------------------
22423_Tthe_DyrkP       KS----------------------------------------------------------
5306_Tthe_DYRK2        QS-NI----S-QPES---------------------------------------------
5356_Tthe_DYRK2        NNSQLNNA-L-SPKK---------------------------------------------
5655_Tthe_DYRK2        QNSRFSSG-P-SPKS---------------------------------------------
15575_Tthe_PRP4        -------Y-K--S-----------------------------------------------
DYRK1_Spur_DYRK1       -------L-K--------------------------------------------------
DYRK2_Spur_DYRK2       -------A-S-R------------------------------------------------
DYRK4_Spur_DYRK2       ---------K-RPRE---------------------------------------------
HIPKa_Spur_HIPK        FG-----S-Q--------------------------------------------------
HIPKb_Spur_HIPK        ------------------------------------------------------------
PRP4_Spur_PRP4         -------A--SK------------------------------------------------
CG7028_Dmel_PRP4       -------R-RAK------------------------------------------------
CC1G_13957_Ccin_DYRK2  -------RPA--------------------------------------------------
CC1G_04865_Ccin_PRP4   -------P-TPP------------------------------------------------
CC1G_14245_Ccin_YAK    -------T-HVE------------------------------------------------
AqueK110_Aque_DYRK1    ------------------------------------------------------------
AqueK111_Aque_DYRK1    ------------------------------------------------------------
AqueK112_Aque_DYRK2    ---------F-SYSK---------------------------------------------
AqueK113_Aque_DYRK2    ------------------------------------------------------------
AqueK114_Aque_HIPK     SN-----K-W--------------------------------------------------
AqueK115_Aque_PRP4     ------------------------------------------------------------
AqueK116_Aque_PRP4     ------------------------------------------------------------
DYRK2_b_Smoe_DYRK2     -------V-A-IPQT---------------------------------------------
DYRK2_a_Smoe_DYRK2     -------V-A-IPQT---------------------------------------------
DYRKP-2_Smoe_DYRKP     ------------------------------------------------------------
DYRKP-1_Smoe_DYRKP     QA----------------------------------------------------------
PRP4_e_Smoe_PRP4       -------E----------------------------------------------------
PRP4_d_Smoe_PRP4       -------E----------------------------------------------------
PRP4_b_Smoe_PRP4       ------------------------------------------------------------
PRP4_a_Smoe_PRP4       ------------------------------------------------------------
PRP4_c_Smoe_PRP4       ------------------------------------------------------------
YAK_b_Smoe_YAK         ------------------------------------------------------------
YAK_a_Smoe_YAK         ------------------------------------------------------------
YAK_d_Smoe_YAK         ------------------------------------------------------------
GK031_Glam_DYRK1       ------------------------------------------------------------
GK034_Glam_DYRK2       -------I-P------------------------GD-HFGLVITSGRSVSKGRDQASD--
GK033_Glam_DYRK2       -------G-E----NELAENVENCESLRRETRITTDLEFLLNISRGCVTVETLANRSAMI
GK032_Glam_DYRK2       SK----------------------------------------------------------


PRP4_Hsap_PRP4         ------------------------------------------------------------
HIPK4_Hsap_HIPK        ------------------------------------------------------------
HIPK3_Hsap_HIPK        ------------------------------------------------------------
HIPK2_Hsap_HIPK        ------------------------------------------------------------
HIPK1_Hsap_HIPK        ------------------------------------------------------------
smi35A_Dmel_DYRK2      ------------------------------------------------------------
mnb_Dmel_DYRK1         ------------------------------------------------------------
Dyrk3_Dmel_DYRK2       ------------------------------------------------------------
CG17090_Dmel_HIPK      ------------------------------------------------------------
PRP4_Mmus_PRP4         ------------------------------------------------------------
HIPK4_Mmus_HIPK        ------------------------------------------------------------
HIPK3_Mmus_HIPK        ------------------------------------------------------------
HIPK2_Mmus_HIPK        ------------------------------------------------------------
HIPK1_Mmus_HIPK        ------------------------------------------------------------
DYRK4_Mmus_DYRK2       ------------------------------------------------------------
DYRK3_Mmus_DYRK2       ------------------------------------------------------------
DYRK2_Mmus_DYRK2       ------------------------------------------------------------
DYRK1B_Mmus_DYRK1      ------------------------------------------------------------
DYRK1A_Mmus_DYRK1      ------------------------------------------------------------
mbk-2_Cele_DYRK2       ------------------------------------------------------------
mbk-1_Cele_DYRK1       ------------------------------------------------------------
hpk-1_Cele_HIPK        ------------------------------------------------------------
F22D6.5_Cele_PRP4      ------------------------------------------------------------
C36B7.2_Cele_DYRK2     ------------------------------------------------------------
C36B7.1_Cele_DYRK2     ------------------------------------------------------------
DYRK4_Hsap_DYRK2       ------------------------------------------------------------
DYRK3_Hsap_DYRK2       ------------------------------------------------------------
DYRK2_Hsap_DYRK2       ------------------------------------------------------------
DYRK1B_Hsap_DYRK1      ------------------------------------------------------------
DYRK1A_Hsap_DYRK1      ------------------------------------------------------------
YAK1_Scer_YAK          ------------------------------------------------------------
Dyrk1_Ddis_DYRK1       ------------------------------------------------------------
Dyrk2_Ddis_DYRK2       ------------------------------------------------------------
Prp4_Ddis_PRP4         ------------------------------------------------------------
YakA_Ddis_YAK          ------------------------------------------------------------
22349_Tthe_YAK         ------------------------------------------------------------
10580_Tthe_DyrkP       ------------------------------------------------------------
22423_Tthe_DyrkP       ------------------------------------------------------------
5306_Tthe_DYRK2        ------------------------------------------------------------
5356_Tthe_DYRK2        ------------------------------------------------------------
5655_Tthe_DYRK2        ------------------------------------------------------------
15575_Tthe_PRP4        ------------------------------------------------------------
DYRK1_Spur_DYRK1       ------------------------------------------------------------
DYRK2_Spur_DYRK2       ------------------------------------------------------------
DYRK4_Spur_DYRK2       ------------------------------------------------------------
HIPKa_Spur_HIPK        ------------------------------------------------------------
HIPKb_Spur_HIPK        ------------------------------------------------------------
PRP4_Spur_PRP4         ------------------------------------------------------------
CG7028_Dmel_PRP4       ------------------------------------------------------------
CC1G_13957_Ccin_DYRK2  ------------------------------------------------------------
CC1G_04865_Ccin_PRP4   ------------------------------------------------------------
CC1G_14245_Ccin_YAK    ------------------------------------------------------------
AqueK110_Aque_DYRK1    ------------------------------------------------------------
AqueK111_Aque_DYRK1    ------------------------------------------------------------
AqueK112_Aque_DYRK2    ------------------------------------------------------------
AqueK113_Aque_DYRK2    ------------------------------------------------------------
AqueK114_Aque_HIPK     ------------------------------------------------------------
AqueK115_Aque_PRP4     ------------------------------------------------------------
AqueK116_Aque_PRP4     ------------------------------------------------------------
DYRK2_b_Smoe_DYRK2     ------------------------------------------------------------
DYRK2_a_Smoe_DYRK2     ------------------------------------------------------------
DYRKP-2_Smoe_DYRKP     ------------------------------------------------------------
DYRKP-1_Smoe_DYRKP     ------------------------------------------------------------
PRP4_e_Smoe_PRP4       ------------------------------------------------------------
PRP4_d_Smoe_PRP4       ------------------------------------------------------------
PRP4_b_Smoe_PRP4       ------------------------------------------------------------
PRP4_a_Smoe_PRP4       ------------------------------------------------------------
PRP4_c_Smoe_PRP4       ------------------------------------------------------------
YAK_b_Smoe_YAK         ------------------------------------------------------------
YAK_a_Smoe_YAK         ------------------------------------------------------------
YAK_d_Smoe_YAK         ------------------------------------------------------------
GK031_Glam_DYRK1       ------------------------------------------------------------
GK034_Glam_DYRK2       ------------------------------------------------------------
GK033_Glam_DYRK2       KEHNMASTIDKFVIHPVFFGRRRALENEFLLEMFRDIDTKVDYLGLVPVTSKRYRMSVCH
GK032_Glam_DYRK2       ------------------------------------------------------------


PRP4_Hsap_PRP4         ---------------------EK-------------------------------------
HIPK4_Hsap_HIPK        ------------------------------------------------------------
HIPK3_Hsap_HIPK        ---------------------SS---------A-F-------------------------
HIPK2_Hsap_HIPK        ---------------------SS---------A-F-------------------------
HIPK1_Hsap_HIPK        ---------------------SS---------A-F-------------------------
smi35A_Dmel_DYRK2      ---------------------DVR-LS-----G---------------------------
mnb_Dmel_DYRK1         ------------------------------------------------------------
Dyrk3_Dmel_DYRK2       ---------------------RH-------------------------------------
CG17090_Dmel_HIPK      ---------------------GS---------G-F-------------------------
PRP4_Mmus_PRP4         ---------------------EK-------------------------------------
HIPK4_Mmus_HIPK        ------------------------------------------------------------
HIPK3_Mmus_HIPK        ---------------------SS---------A-F-------------------------
HIPK2_Mmus_HIPK        ---------------------SS---------A-F-------------------------
HIPK1_Mmus_HIPK        ---------------------SS---------A-F-------------------------
DYRK4_Mmus_DYRK2       ---------------------R-S-LT-----T-F-------------------------
DYRK3_Mmus_DYRK2       ---------------------QRR-LGDGVYDT-F-------------------------
DYRK2_Mmus_DYRK2       ---------------------DT-------------------------------------
DYRK1B_Mmus_DYRK1      ------------------------------------------------------------
DYRK1A_Mmus_DYRK1      ---------------------LA---------P---------------------------
mbk-2_Cele_DYRK2       ---------------------DR-------------------------------------
mbk-1_Cele_DYRK1       ---------------------PL---------TTLFRALSFTCDLSSVFLFASPMNFYRF
hpk-1_Cele_HIPK        ------------------------------------------------------------
F22D6.5_Cele_PRP4      ---------------------DE-------------------------------------
C36B7.2_Cele_DYRK2     ---------------------LT---------K-L-------------------------
C36B7.1_Cele_DYRK2     --------------------------------A-F-------------------------
DYRK4_Hsap_DYRK2       ---------------------C-D-LT-----P-F-------------------------
DYRK3_Hsap_DYRK2       ---------------------QRR-LGDGVYDT-F-------------------------
DYRK2_Hsap_DYRK2       ---------------------DS-------------------------------------
DYRK1B_Hsap_DYRK1      ------------------------------------------------------------
DYRK1A_Hsap_DYRK1      ---------------------LA---------P---------------------------
YAK1_Scer_YAK          ---------------------PT---------L---------------------------
Dyrk1_Ddis_DYRK1       ----------------------K---------L---------------------------
Dyrk2_Ddis_DYRK2       ---------------------LK---------S---------------------------
Prp4_Ddis_PRP4         ---------------------PK-------------------------------------
YakA_Ddis_YAK          ---------------------SS---------M---------------------------
22349_Tthe_YAK         ---------------------RF---------L---------------------------
10580_Tthe_DyrkP       ---------------------SQ---------S---------------------------
22423_Tthe_DyrkP       ---------------------LK---------A-F-------------------------
5306_Tthe_DYRK2        ----------------------TKNHF-----G-Y-------------------------
5356_Tthe_DYRK2        ----------------------NI-SL-----D-L-------------------------
5655_Tthe_DYRK2        ----------------------KN-FV-----P-I-------------------------
15575_Tthe_PRP4        ---------------------PK-------------------------------------
DYRK1_Spur_DYRK1       ---------------------DR---------K---------------------------
DYRK2_Spur_DYRK2       ---------------------TR-------------------------------------
DYRK4_Spur_DYRK2       ---------------------KNH-IS-------N-------------------------
HIPKa_Spur_HIPK        ---------------------SS---------A-F-------------------------
HIPKb_Spur_HIPK        ------------------------------------------------------------
PRP4_Spur_PRP4         ---------------------ED-------------------------------------
CG7028_Dmel_PRP4       ---------------------HK-------------------------------------
CC1G_13957_Ccin_DYRK2  ---------------------AL---------A---------------------------
CC1G_04865_Ccin_PRP4   ---------------------QK-------------------------------------
CC1G_14245_Ccin_YAK    ---------------------PA---------A---------------------------
AqueK110_Aque_DYRK1    ------------------------------------------------------------
AqueK111_Aque_DYRK1    ------------------------------------------------------------
AqueK112_Aque_DYRK2    ---------------------ATP-LL---------------------------------
AqueK113_Aque_DYRK2    ---------------------TK-------------------------------------
AqueK114_Aque_HIPK     ---------------------SS---------C-L-------------------------
AqueK115_Aque_PRP4     ------------------------------------------------------------
AqueK116_Aque_PRP4     ------------------------------------------------------------
DYRK2_b_Smoe_DYRK2     ------------------------------------------------------------
DYRK2_a_Smoe_DYRK2     ------------------------------------------------------------
DYRKP-2_Smoe_DYRKP     ------------------------------------------------------------
DYRKP-1_Smoe_DYRKP     ---------------------EA---------A-L-------------------------
PRP4_e_Smoe_PRP4       ---------------------DA-------------------------------------
PRP4_d_Smoe_PRP4       ---------------------DA-------------------------------------
PRP4_b_Smoe_PRP4       ---------------------RK-------------------------------------
PRP4_a_Smoe_PRP4       ---------------------RK-------------------------------------
PRP4_c_Smoe_PRP4       ------------------------------------------------------------
YAK_b_Smoe_YAK         ------------------------------------------------------------
YAK_a_Smoe_YAK         ------------------------------------------------------------
YAK_d_Smoe_YAK         ------------------------------------------------------------
GK031_Glam_DYRK1       --------------------------------K---------------------------
GK034_Glam_DYRK2       ---------------------AP---------P---------------------------
GK033_Glam_DYRK2       KQPYQHLYLKRIFPADQKLKGLA---------P---------------------------
GK032_Glam_DYRK2       ---------------------LV---------A-S-------------------------


PRP4_Hsap_PRP4         ----------------------SI------------------------------------
HIPK4_Hsap_HIPK        ------------------------------------------------------------
HIPK3_Hsap_HIPK        ---------------------CSV------------------------------------
HIPK2_Hsap_HIPK        ---------------------CSV------------------------------------
HIPK1_Hsap_HIPK        ---------------------CSA------------------------------------
smi35A_Dmel_DYRK2      ---------------------SRL------------------------------------
mnb_Dmel_DYRK1         ------------------------------------------------------------
Dyrk3_Dmel_DYRK2       ----------------------QY------------------------------------
CG17090_Dmel_HIPK      ---------------------CSG------------------------------------
PRP4_Mmus_PRP4         ----------------------SV------------------------------------
HIPK4_Mmus_HIPK        ------------------------------------------------------------
HIPK3_Mmus_HIPK        ---------------------CSV------------------------------------
HIPK2_Mmus_HIPK        ---------------------CSV------------------------------------
HIPK1_Mmus_HIPK        ---------------------CSA------------------------------------
DYRK4_Mmus_DYRK2       ---------------------PIL------------------------------------
DYRK3_Mmus_DYRK2       ---------------------MMI------------------------------------
DYRK2_Mmus_DYRK2       ----------------------AV------------------------------------
DYRK1B_Mmus_DYRK1      ------------------------------------------------------------
DYRK1A_Mmus_DYRK1      ------------------------------------------------------------
mbk-2_Cele_DYRK2       ----------------------SV------------------------------------
mbk-1_Cele_DYRK1       INNCSGTTCFFLENMNTADVPDNL------------------------------------
hpk-1_Cele_HIPK        ------------------------------------------------------------
F22D6.5_Cele_PRP4      ----------------------KA------------------------------------
C36B7.2_Cele_DYRK2     ---------------------WA-------------------------------------
C36B7.1_Cele_DYRK2     ---------------------FQ-------------------------------------
DYRK4_Hsap_DYRK2       ---------------------LVL------------------------------------
DYRK3_Hsap_DYRK2       ---------------------MMI------------------------------------
DYRK2_Hsap_DYRK2       ----------------------AV------------------------------------
DYRK1B_Hsap_DYRK1      ------------------------------------------------------------
DYRK1A_Hsap_DYRK1      ------------------------------------------------------------
YAK1_Scer_YAK          ----------------------VT------------------------------------
Dyrk1_Ddis_DYRK1       ----------------------SI------------------------------------
Dyrk2_Ddis_DYRK2       -----------------------------------S--------------M---------
Prp4_Ddis_PRP4         ----------------------KV------------------------------------
YakA_Ddis_YAK          ----------------------VT------------------------------------
22349_Tthe_YAK         ----------------------TV------------------------------------
10580_Tthe_DyrkP       ------------------------------------------------------------
22423_Tthe_DyrkP       ---------------------QD-------------------------------------
5306_Tthe_DYRK2        ------------------------------------------------------------
5356_Tthe_DYRK2        ---------------------G--------------------------------------
5655_Tthe_DYRK2        ---------------------T--------------------------------------
15575_Tthe_PRP4        ----------------------QK------------------------------------
DYRK1_Spur_DYRK1       ------------------------------------------------------------
DYRK2_Spur_DYRK2       ----------------------SL------------------------------------
DYRK4_Spur_DYRK2       ---------------------GAV------------------------------------
HIPKa_Spur_HIPK        ---------------------CSF------------------------------------
HIPKb_Spur_HIPK        ------------------------------------------------------------
PRP4_Spur_PRP4         ----------------------SG------------------------------------
CG7028_Dmel_PRP4       ----------------------KA------------------------------------
CC1G_13957_Ccin_DYRK2  -----------------------------------IHDDEGTQPSDGDDQIDNCQHQHLL
CC1G_04865_Ccin_PRP4   ----------------------SE------------------------------------
CC1G_14245_Ccin_YAK    ----------------------QA------------------------------------
AqueK110_Aque_DYRK1    ------------------------------------------------------------
AqueK111_Aque_DYRK1    ------------------------------------------------------------
AqueK112_Aque_DYRK2    ---------------------PSL------------------------------------
AqueK113_Aque_DYRK2    ----------------------TF------------------------------------
AqueK114_Aque_HIPK     ---------------------W--------------------------------------
AqueK115_Aque_PRP4     ------------------------------------------------------------
AqueK116_Aque_PRP4     ------------------------------------------------------------
DYRK2_b_Smoe_DYRK2     ----------------------VV------------------------------------
DYRK2_a_Smoe_DYRK2     ----------------------VV------------------------------------
DYRKP-2_Smoe_DYRKP     ------------------------------------------------------------
DYRKP-1_Smoe_DYRKP     ---------------------KA-------------------------------------
PRP4_e_Smoe_PRP4       ------------------------------------------------------------
PRP4_d_Smoe_PRP4       ------------------------------------------------------------
PRP4_b_Smoe_PRP4       ----------------------SV------------------------------------
PRP4_a_Smoe_PRP4       ----------------------SV------------------------------------
PRP4_c_Smoe_PRP4       ------------------------------------------------------------
YAK_b_Smoe_YAK         ------------------------------------------------------------
YAK_a_Smoe_YAK         ------------------------------------------------------------
YAK_d_Smoe_YAK         ------------------------------------------------------------
GK031_Glam_DYRK1       ------------------------------------------------------------
GK034_Glam_DYRK2       ------------------------PPPARSAAVARA------------------------
GK033_Glam_DYRK2       -----------------------DSPPAM-------------------------------
GK032_Glam_DYRK2       ---------------------ES-------------------------------------


PRP4_Hsap_PRP4         ------------------------------------------------------------
HIPK4_Hsap_HIPK        ------------------------------------------------------------
HIPK3_Hsap_HIPK        ------------------------------------------------------------
HIPK2_Hsap_HIPK        ------------------------------------------------------------
HIPK1_Hsap_HIPK        ------------------------------------------------------------
smi35A_Dmel_DYRK2      ------------------------------------------------------------
mnb_Dmel_DYRK1         ------------------------------------------------------------
Dyrk3_Dmel_DYRK2       ------------------------------------------------------------
CG17090_Dmel_HIPK      ------------------------------------------------------------
PRP4_Mmus_PRP4         ------------------------------------------------------------
HIPK4_Mmus_HIPK        ------------------------------------------------------------
HIPK3_Mmus_HIPK        ------------------------------------------------------------
HIPK2_Mmus_HIPK        ------------------------------------------------------------
HIPK1_Mmus_HIPK        ------------------------------------------------------------
DYRK4_Mmus_DYRK2       ------------------------------------------------------------
DYRK3_Mmus_DYRK2       ------------------------------------------------------------
DYRK2_Mmus_DYRK2       ------------------------------------------------------------
DYRK1B_Mmus_DYRK1      ------------------------------------------------------------
DYRK1A_Mmus_DYRK1      ------------------------------------------------------------
mbk-2_Cele_DYRK2       ------------------------------------------------------------
mbk-1_Cele_DYRK1       ------------------------------------------------------------
hpk-1_Cele_HIPK        ------------------------------------------------------------
F22D6.5_Cele_PRP4      ------------------------------------------------------------
C36B7.2_Cele_DYRK2     ------------------------------------------------------------
C36B7.1_Cele_DYRK2     ------------------------------------------------------------
DYRK4_Hsap_DYRK2       ------------------------------------------------------------
DYRK3_Hsap_DYRK2       ------------------------------------------------------------
DYRK2_Hsap_DYRK2       ------------------------------------------------------------
DYRK1B_Hsap_DYRK1      ------------------------------------------------------------
DYRK1A_Hsap_DYRK1      ------------------------------------------------------------
YAK1_Scer_YAK          ------------------------------------------------------------
Dyrk1_Ddis_DYRK1       ------------------------------------------------------------
Dyrk2_Ddis_DYRK2       --------------STRAAARRSV--CLSSMSYTLGADDVTPITSNTTP----------S
Prp4_Ddis_PRP4         ------------------------------------------------------------
YakA_Ddis_YAK          ------------------------------------------------------------
22349_Tthe_YAK         ------------------------------------------------------------
10580_Tthe_DyrkP       ------------------------------------------------------------
22423_Tthe_DyrkP       ----------------D-------------------------------M----------E
5306_Tthe_DYRK2        ------------------------------------------------------------
5356_Tthe_DYRK2        ------------------------------------------------------------
5655_Tthe_DYRK2        ------------------------------------------------------------
15575_Tthe_PRP4        ------------------------------------------------------------
DYRK1_Spur_DYRK1       --------------------RRSLNGC----------DD---------------------
DYRK2_Spur_DYRK2       ------------------------------------------------------------
DYRK4_Spur_DYRK2       ------------------------------------------------------------
HIPKa_Spur_HIPK        ------------------------------------------------------------
HIPKb_Spur_HIPK        ------------------------------------------------------------
PRP4_Spur_PRP4         ------------------------------------------------------------
CG7028_Dmel_PRP4       ------------------------------------------------------------
CC1G_13957_Ccin_DYRK2  QPLTINVSHQDNDDS--NHSRS--------------------------------------
CC1G_04865_Ccin_PRP4   ------------------------------------------------------------
CC1G_14245_Ccin_YAK    ------------------------------------------------------------
AqueK110_Aque_DYRK1    ------------------------------------------------------------
AqueK111_Aque_DYRK1    ------------------------------------------------------------
AqueK112_Aque_DYRK2    ------------------------------------------------------------
AqueK113_Aque_DYRK2    ------------------------------------------------------------
AqueK114_Aque_HIPK     ------------------------------------------------------------
AqueK115_Aque_PRP4     ------------------------------------------------------------
AqueK116_Aque_PRP4     ------------------------------------------------------------
DYRK2_b_Smoe_DYRK2     ------------------------------------------------------------
DYRK2_a_Smoe_DYRK2     ------------------------------------------------------------
DYRKP-2_Smoe_DYRKP     ------------------------------------------------------------
DYRKP-1_Smoe_DYRKP     ----------------E-------------------------------LAGREVSNGLFS
PRP4_e_Smoe_PRP4       ------------------------------------------------------------
PRP4_d_Smoe_PRP4       ------------------------------------------------------------
PRP4_b_Smoe_PRP4       ------------------------------------------------------------
PRP4_a_Smoe_PRP4       ------------------------------------------------------------
PRP4_c_Smoe_PRP4       ------------------------------------------------------------
YAK_b_Smoe_YAK         ------------------------------------------------------------
YAK_a_Smoe_YAK         ------------------------------------------------------------
YAK_d_Smoe_YAK         ------------------------------------------------------------
GK031_Glam_DYRK1       ------------------------------------------------------------
GK034_Glam_DYRK2       --------------------RR--------------------------------------
GK033_Glam_DYRK2       ------------------------------------------------------------
GK032_Glam_DYRK2       ----------------E-------------------------------P----------S


PRP4_Hsap_PRP4         ------------------------------------------------------------
HIPK4_Hsap_HIPK        ------------------------------------------------------------
HIPK3_Hsap_HIPK        ------------------------------------------------------------
HIPK2_Hsap_HIPK        ------------------------------------------------------------
HIPK1_Hsap_HIPK        ------------------------------------------------------------
smi35A_Dmel_DYRK2      ------------------------------------------------------------
mnb_Dmel_DYRK1         ------------------------------------------------------------
Dyrk3_Dmel_DYRK2       ------------------------------------------------------------
CG17090_Dmel_HIPK      ------------------------------------------------------------
PRP4_Mmus_PRP4         ------------------------------------------------------------
HIPK4_Mmus_HIPK        ------------------------------------------------------------
HIPK3_Mmus_HIPK        ------------------------------------------------------------
HIPK2_Mmus_HIPK        ------------------------------------------------------------
HIPK1_Mmus_HIPK        ------------------------------------------------------------
DYRK4_Mmus_DYRK2       ------------------------------------------------------------
DYRK3_Mmus_DYRK2       ------------------------------------------------------------
DYRK2_Mmus_DYRK2       ------------------------------------------------------------
DYRK1B_Mmus_DYRK1      ------------------------------------------------------------
DYRK1A_Mmus_DYRK1      ------------------------------------------------------------
mbk-2_Cele_DYRK2       ------------------------------------------------------------
mbk-1_Cele_DYRK1       ------------------------------------------------------------
hpk-1_Cele_HIPK        ------------------------------------------------------------
F22D6.5_Cele_PRP4      ------------------------------------------------------------
C36B7.2_Cele_DYRK2     ------------------------------------------------------------
C36B7.1_Cele_DYRK2     ------------------------------------------------------------
DYRK4_Hsap_DYRK2       ------------------------------------------------------------
DYRK3_Hsap_DYRK2       ------------------------------------------------------------
DYRK2_Hsap_DYRK2       ------------------------------------------------------------
DYRK1B_Hsap_DYRK1      ------------------------------------------------------------
DYRK1A_Hsap_DYRK1      ------------------------------------------------------------
YAK1_Scer_YAK          ------------------------------------------------------------
Dyrk1_Ddis_DYRK1       ------------------------------------------------------------
Dyrk2_Ddis_DYRK2       NNNNNNNTTTTITTTTT-------------------------------------------
Prp4_Ddis_PRP4         ------------------------------------------------------------
YakA_Ddis_YAK          ------------------------------------------------------------
22349_Tthe_YAK         ------------------------------------------------------------
10580_Tthe_DyrkP       ------------------------------------------------------------
22423_Tthe_DyrkP       ------------------------------------------------------------
5306_Tthe_DYRK2        ------------------------------------------------------------
5356_Tthe_DYRK2        ------------------------------------------------------------
5655_Tthe_DYRK2        ------------------------------------------------------------
15575_Tthe_PRP4        ------------------------------------------------------------
DYRK1_Spur_DYRK1       ------------------------------------------------------------
DYRK2_Spur_DYRK2       ------------------------------------------------------------
DYRK4_Spur_DYRK2       ------------------------------------------------------------
HIPKa_Spur_HIPK        ------------------------------------------------------------
HIPKb_Spur_HIPK        ------------------------------------------------------------
PRP4_Spur_PRP4         ------------------------------------------------------------
CG7028_Dmel_PRP4       ------------------------------------------------------------
CC1G_13957_Ccin_DYRK2  ----------------TSVTSSLDPYYFGLAESPEHNPNQLSITPDHPPPNEPVTPARNP
CC1G_04865_Ccin_PRP4   ------------------------------------------------------------
CC1G_14245_Ccin_YAK    ------------------------------------------------------------
AqueK110_Aque_DYRK1    ------------------------------------------------------------
AqueK111_Aque_DYRK1    ------------------------------------------------------------
AqueK112_Aque_DYRK2    ------------------------------------------------------------
AqueK113_Aque_DYRK2    ------------------------------------------------------------
AqueK114_Aque_HIPK     ------------------------------------------------------------
AqueK115_Aque_PRP4     ------------------------------------------------------------
AqueK116_Aque_PRP4     ------------------------------------------------------------
DYRK2_b_Smoe_DYRK2     ------------------------------------------------------------
DYRK2_a_Smoe_DYRK2     ------------------------------------------------------------
DYRKP-2_Smoe_DYRKP     ------------------------------------------------------------
DYRKP-1_Smoe_DYRKP     ------------------------------------------------------------
PRP4_e_Smoe_PRP4       ------------------------------------------------------------
PRP4_d_Smoe_PRP4       ------------------------------------------------------------
PRP4_b_Smoe_PRP4       ------------------------------------------------------------
PRP4_a_Smoe_PRP4       ------------------------------------------------------------
PRP4_c_Smoe_PRP4       ------------------------------------------------------------
YAK_b_Smoe_YAK         ------------------------------------------------------------
YAK_a_Smoe_YAK         ------------------------------------------------------------
YAK_d_Smoe_YAK         ------------------------------------------------------------
GK031_Glam_DYRK1       ------------------------------------------------------------
GK034_Glam_DYRK2       ------------------------------------------------------------
GK033_Glam_DYRK2       ------------------------------------------------------------
GK032_Glam_DYRK2       AL----------------------------------------------------------


PRP4_Hsap_PRP4         ------------------------------------------------------------
HIPK4_Hsap_HIPK        ------------------------------------------------------------
HIPK3_Hsap_HIPK        ------------------------------------------------------------
HIPK2_Hsap_HIPK        ------------------------------------------------------------
HIPK1_Hsap_HIPK        ------------------------------------------------------------
smi35A_Dmel_DYRK2      ------------------------------------------------------------
mnb_Dmel_DYRK1         ------------------------------------------------------------
Dyrk3_Dmel_DYRK2       ------------------------------------------------------------
CG17090_Dmel_HIPK      ------------------------------------------------------------
PRP4_Mmus_PRP4         ------------------------------------------------------------
HIPK4_Mmus_HIPK        ------------------------------------------------------------
HIPK3_Mmus_HIPK        ------------------------------------------------------------
HIPK2_Mmus_HIPK        ------------------------------------------------------------
HIPK1_Mmus_HIPK        ------------------------------------------------------------
DYRK4_Mmus_DYRK2       ------------------------------------------------------------
DYRK3_Mmus_DYRK2       ------------------------------------------------------------
DYRK2_Mmus_DYRK2       ------------------------------------------------------------
DYRK1B_Mmus_DYRK1      ------------------------------------------------------------
DYRK1A_Mmus_DYRK1      ------------------------------------------------------------
mbk-2_Cele_DYRK2       ------------------------------------------------------------
mbk-1_Cele_DYRK1       ------------------------------------------------------------
hpk-1_Cele_HIPK        ------------------------------------------------------------
F22D6.5_Cele_PRP4      ------------------------------------------------------------
C36B7.2_Cele_DYRK2     ------------------------------------------------------------
C36B7.1_Cele_DYRK2     ------------------------------------------------------------
DYRK4_Hsap_DYRK2       ------------------------------------------------------------
DYRK3_Hsap_DYRK2       ------------------------------------------------------------
DYRK2_Hsap_DYRK2       ------------------------------------------------------------
DYRK1B_Hsap_DYRK1      ------------------------------------------------------------
DYRK1A_Hsap_DYRK1      ------------------------------------------------------------
YAK1_Scer_YAK          ------------------------------------------------------------
Dyrk1_Ddis_DYRK1       ------------------------------------------------------------
Dyrk2_Ddis_DYRK2       ------------------------------------------------------------
Prp4_Ddis_PRP4         ------------------------------------------------------------
YakA_Ddis_YAK          ------------------------------------------------------------
22349_Tthe_YAK         ------------------------------------------------------------
10580_Tthe_DyrkP       ------------------------------------------------------------
22423_Tthe_DyrkP       ------------------------------------------------------------
5306_Tthe_DYRK2        ------------------------------------------------------------
5356_Tthe_DYRK2        ------------------------------------------------------------
5655_Tthe_DYRK2        ------------------------------------------------------------
15575_Tthe_PRP4        ------------------------------------------------------------
DYRK1_Spur_DYRK1       ------------------------------------------------------------
DYRK2_Spur_DYRK2       ------------------------------------------------------------
DYRK4_Spur_DYRK2       ------------------------------------------------------------
HIPKa_Spur_HIPK        ------------------------------------------------------------
HIPKb_Spur_HIPK        ------------------------------------------------------------
PRP4_Spur_PRP4         ------------------------------------------------------------
CG7028_Dmel_PRP4       ------------------------------------------------------------
CC1G_13957_Ccin_DYRK2  ASIDRRGLVGVGELATPRWTRDPSPDPHLDDDVPPLPDR-------PEDDAPD-------
CC1G_04865_Ccin_PRP4   ------------------------------------------------------------
CC1G_14245_Ccin_YAK    ------------------------------------------------------------
AqueK110_Aque_DYRK1    ------------------------------------------------------------
AqueK111_Aque_DYRK1    ------------------------------------------------------------
AqueK112_Aque_DYRK2    ------------------------------------------------------------
AqueK113_Aque_DYRK2    ------------------------------------------------------------
AqueK114_Aque_HIPK     ------------------------------------------------------------
AqueK115_Aque_PRP4     ------------------------------------------------------------
AqueK116_Aque_PRP4     ------------------------------------------------------------
DYRK2_b_Smoe_DYRK2     ------------------------------------------------------------
DYRK2_a_Smoe_DYRK2     ------------------------------------------------------------
DYRKP-2_Smoe_DYRKP     ------------------------------------------------------------
DYRKP-1_Smoe_DYRKP     ------------------------------------------------------------
PRP4_e_Smoe_PRP4       ------------------------------------------------------------
PRP4_d_Smoe_PRP4       ------------------------------------------------------------
PRP4_b_Smoe_PRP4       ------------------------------------------------------------
PRP4_a_Smoe_PRP4       ------------------------------------------------------------
PRP4_c_Smoe_PRP4       ------------------------------------------------------------
YAK_b_Smoe_YAK         ------------------------------------------------------------
YAK_a_Smoe_YAK         ------------------------------------------------------------
YAK_d_Smoe_YAK         ------------------------------------------------------------
GK031_Glam_DYRK1       ------------------------------------------------------------
GK034_Glam_DYRK2       ------------------------------------------------------------
GK033_Glam_DYRK2       ------------------------------------------------------------
GK032_Glam_DYRK2       -------------------------------------ELLVTYGFTEGDSVHIKTFTQCN


PRP4_Hsap_PRP4         ------------------------------------------------------------
HIPK4_Hsap_HIPK        ------------------------------------------------------------
HIPK3_Hsap_HIPK        ------------------------------------------------------------
HIPK2_Hsap_HIPK        ------------------------------------------------------------
HIPK1_Hsap_HIPK        ------------------------------------------------------------
smi35A_Dmel_DYRK2      ------------------------------------------------------------
mnb_Dmel_DYRK1         ------------------------------------------------------------
Dyrk3_Dmel_DYRK2       ------------------------------------------------------------
CG17090_Dmel_HIPK      ------------------------------------------------------------
PRP4_Mmus_PRP4         ------------------------------------------------------------
HIPK4_Mmus_HIPK        ------------------------------------------------------------
HIPK3_Mmus_HIPK        ------------------------------------------------------------
HIPK2_Mmus_HIPK        ------------------------------------------------------------
HIPK1_Mmus_HIPK        ------------------------------------------------------------
DYRK4_Mmus_DYRK2       ------------------------------------------------------------
DYRK3_Mmus_DYRK2       ------------------------------------------------------------
DYRK2_Mmus_DYRK2       ------------------------------------------------------------
DYRK1B_Mmus_DYRK1      ------------------------------------------------------------
DYRK1A_Mmus_DYRK1      ------------------------------------------------------------
mbk-2_Cele_DYRK2       ------------------------------------------------------------
mbk-1_Cele_DYRK1       ------------------------------------------------------------
hpk-1_Cele_HIPK        ------------------------------------------------------------
F22D6.5_Cele_PRP4      ------------------------------------------------------------
C36B7.2_Cele_DYRK2     --DH--------------------------------------------------------
C36B7.1_Cele_DYRK2     --LR--------------------------------------------------------
DYRK4_Hsap_DYRK2       ------------------------------------------------------------
DYRK3_Hsap_DYRK2       ------------------------------------------------------------
DYRK2_Hsap_DYRK2       ------------------------------------------------------------
DYRK1B_Hsap_DYRK1      ------------------------------------------------------------
DYRK1A_Hsap_DYRK1      ------------------------------------------------------------
YAK1_Scer_YAK          ------------------------------------------------------------
Dyrk1_Ddis_DYRK1       ------------------------------------------------------------
Dyrk2_Ddis_DYRK2       ------------------------------------------------------------
Prp4_Ddis_PRP4         ------------------------------------------------------------
YakA_Ddis_YAK          ------------------------------------------------------------
22349_Tthe_YAK         ------------------------------------------------------------
10580_Tthe_DyrkP       --IN--------------------------------------------------------
22423_Tthe_DyrkP       --IY--------------------------------------------------------
5306_Tthe_DYRK2        ------------------------------------------------------------
5356_Tthe_DYRK2        ------------------------------------------------------------
5655_Tthe_DYRK2        ------------------------------------------------------------
15575_Tthe_PRP4        ------------------------------------------------------------
DYRK1_Spur_DYRK1       --VYCL------------------------------------------------------
DYRK2_Spur_DYRK2       ------------------------------------------------------------
DYRK4_Spur_DYRK2       ------------------------------------------------------------
HIPKa_Spur_HIPK        ------------------------------------------------------------
HIPKb_Spur_HIPK        ------------------------------------------------------------
PRP4_Spur_PRP4         ------------------------------------------------------------
CG7028_Dmel_PRP4       ------------------------------------------------------------
CC1G_13957_Ccin_DYRK2  --SPWTIEAIDGELSDSDEVSAPAPFPASNNVLIFLKVKIPELPPPARPLRTRPSIADES
CC1G_04865_Ccin_PRP4   ------------------------------------------------------------
CC1G_14245_Ccin_YAK    ------------------------------------------------------------
AqueK110_Aque_DYRK1    ------------------------------------------------------------
AqueK111_Aque_DYRK1    ------------------------------------------------------------
AqueK112_Aque_DYRK2    ------------------------------------------------------------
AqueK113_Aque_DYRK2    ------------------------------------------------------------
AqueK114_Aque_HIPK     ------------------------------------------------------------
AqueK115_Aque_PRP4     ------------------------------------------------------------
AqueK116_Aque_PRP4     ------------------------------------------------------------
DYRK2_b_Smoe_DYRK2     ------------------------------------------------------------
DYRK2_a_Smoe_DYRK2     ------------------------------------------------------------
DYRKP-2_Smoe_DYRKP     ------------------------------------------------------------
DYRKP-1_Smoe_DYRKP     --ID--------------------------------------------------------
PRP4_e_Smoe_PRP4       ------------------------------------------------------------
PRP4_d_Smoe_PRP4       ------------------------------------------------------------
PRP4_b_Smoe_PRP4       ------------------------------------------------------------
PRP4_a_Smoe_PRP4       ------------------------------------------------------------
PRP4_c_Smoe_PRP4       ------------------------------------------------------------
YAK_b_Smoe_YAK         ------------------------------------------------------------
YAK_a_Smoe_YAK         ------------------------------------------------------------
YAK_d_Smoe_YAK         ------------------------------------------------------------
GK031_Glam_DYRK1       ------------------------------------------------------------
GK034_Glam_DYRK2       ------------------------------------------------------------
GK033_Glam_DYRK2       ------------------------------------------------------------
GK032_Glam_DYRK2       DALL--------------------------------------------------------


PRP4_Hsap_PRP4         ------------------------------------------------------------
HIPK4_Hsap_HIPK        ------------------------------------------------------------
HIPK3_Hsap_HIPK        ------------------------------------------------------------
HIPK2_Hsap_HIPK        ------------------------------------------------------------
HIPK1_Hsap_HIPK        ------------------------------------------------------------
smi35A_Dmel_DYRK2      ------------------------------------------------------------
mnb_Dmel_DYRK1         ------------------------------------------------------------
Dyrk3_Dmel_DYRK2       ------------------------------------------------------------
CG17090_Dmel_HIPK      ------------------------------------------------------------
PRP4_Mmus_PRP4         ------------------------------------------------------------
HIPK4_Mmus_HIPK        ------------------------------------------------------------
HIPK3_Mmus_HIPK        ------------------------------------------------------------
HIPK2_Mmus_HIPK        ------------------------------------------------------------
HIPK1_Mmus_HIPK        ------------------------------------------------------------
DYRK4_Mmus_DYRK2       ------------------------------------------------------------
DYRK3_Mmus_DYRK2       ------------------------------------------------------------
DYRK2_Mmus_DYRK2       ------------------------------------------------------------
DYRK1B_Mmus_DYRK1      ------------------------------------------------------------
DYRK1A_Mmus_DYRK1      ------------------------------------------------------------
mbk-2_Cele_DYRK2       ------------------------------------------------------------
mbk-1_Cele_DYRK1       ------------------------------------------------------------
hpk-1_Cele_HIPK        ------------------------------------------------------------
F22D6.5_Cele_PRP4      ------------------------------------------------------------
C36B7.2_Cele_DYRK2     ------------------------------------------------------------
C36B7.1_Cele_DYRK2     ------------------------------------------------------------
DYRK4_Hsap_DYRK2       ------------------------------------------------------------
DYRK3_Hsap_DYRK2       ------------------------------------------------------------
DYRK2_Hsap_DYRK2       ------------------------------------------------------------
DYRK1B_Hsap_DYRK1      ------------------------------------------------------------
DYRK1A_Hsap_DYRK1      ------------------------------------------------------------
YAK1_Scer_YAK          ------------------------------------------------------------
Dyrk1_Ddis_DYRK1       ------------------------------------------------------------
Dyrk2_Ddis_DYRK2       ------------------------------------------TPTISPLKQSTTGSIIPK
Prp4_Ddis_PRP4         ------------------------------------------------------------
YakA_Ddis_YAK          ---------------------------------------------------